KEGG   Homo sapiens (human): 399949
Entry
399949            CDS       T01001                                 
Symbol
HOATZ, C11orf88
Name
(RefSeq) HOATZ cilia and flagella associated protein
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: HOATZ-like DFF-C DUF4239 TadB_TadC_N
Other DBs
NCBI-GeneID: 399949
NCBI-ProteinID: NP_001093858
HGNC: 25061
Ensembl: ENSG00000183644
Pharos: Q6PI97(Tdark)
UniProt: Q6PI97
Position
11:111514778..111537043
AA seq 169 aa
METGPSEEPSGRKESQEMCPPGLLVFAGSSEQDANLAKQFWISASMYPPSESQLVLRRDS
SQRLPVARPRRSRGSENSHSSQSFHLASNKNRDIFAEALKIQESEEKVKYLQKAKTREEI
LQLLRKQREERISKELISLPYKPKAKEHKAKKVVSESDKEDQEEVKTLD
NT seq 510 nt   +upstreamnt  +downstreamnt
atggaaacgggacccagcgaagaacctagcggccgaaaagagtcccaggaaatgtgcccc
ccgggattactggtatttgctggctcctcggaacaagatgccaacttggctaagcagttc
tggatctcggcgtcgatgtatccccctagcgaatctcagctggtgctgcgcagagacagc
agtcagcgtctgccggtggcgcggcccaggaggagcagagggtctgaaaacagccactcc
tcgcagtcttttcaccttgcgagtaacaaaaatagagacatctttgccgaagccctaaag
atacaggaatctgaggagaaagtaaagtatctccaaaaggctaaaacaagagaagagatt
ctccaactcttaagaaaacaaagagaagaaaggatctcgaaagaactgatttcccttccg
tataaaccaaaagccaaagaacacaaagcaaagaaagtggtatcagagtcagataaagag
gaccaagaagaagtcaaaactttggactaa

DBGET integrated database retrieval system