KEGG   Homo sapiens (human): 400916
Entry
400916            CDS       T01001                                 
Symbol
CHCHD10, C22orf16, FTDALS2, IMMD, MIX17A, N27C7-4, SMAJ
Name
(RefSeq) coiled-coil-helix-coiled-coil-helix domain containing 10
  KO
K22759  coiled-coil-helix-coiled-coil-helix domain-containing protein 10
Organism
hsa  Homo sapiens (human)
Pathway
hsa05014  Amyotrophic lateral sclerosis
Disease
H02342  Frontotemporal dementia and amyotrophic lateral sclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    400916 (CHCHD10)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    400916 (CHCHD10)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial protein import machinery
  Inner mambrane
   Other inner membrane factors
    400916 (CHCHD10)
SSDB
Motif
Pfam: CHCH DUF2076 Cmc1
Other DBs
NCBI-GeneID: 400916
NCBI-ProteinID: NP_998885
OMIM: 615903
HGNC: 15559
Ensembl: ENSG00000250479
Pharos: Q8WYQ3(Tbio)
UniProt: Q8WYQ3
Position
22:complement(23765834..23767972)
AA seq 142 aa
MPRGSRSAASRPASRPAAPSAHPPAHPPPSAAAPAPAPSGQPGLMAQMATTAAGVAVGSA
VGHVMGSALTGAFSGGSSEPSQPAVQQAPTPAAPQPLQMGPCAYEIRQFLDCSTTQSDLS
LCEGFSEALKQCKYYHGLSSLP
NT seq 429 nt   +upstreamnt  +downstreamnt
atgcctcggggaagccgcagcgcggcctcccggccagccagccgcccagccgcgccctct
gcccacccgcccgcgcacccaccgccctcggcagccgccccagcccccgccccttcgggc
cagccggggctcatggctcagatggcgaccacggccgcaggggtagccgtgggctcggct
gtgggacacgtcatgggcagcgccctgaccggagccttcagcggggggagctcggagccc
tcccagcctgctgtccagcaggcccccacccccgctgccccccagcccctgcagatgggg
ccctgcgcctacgagatcaggcagttcctggactgttccaccactcagagtgacctgtcc
ctgtgtgagggcttcagcgaggccctgaagcagtgcaagtactaccatggtctgagctcc
ctgccctga

DBGET integrated database retrieval system