KEGG   Homo sapiens (human): 400916Help
Entry
400916            CDS       T01001                                 

Gene name
CHCHD10, C22orf16, FTDALS2, IMMD, MIX17A, N27C7-4, SMAJ
Definition
(RefSeq) coiled-coil-helix-coiled-coil-helix domain containing 10
  KO
K22759  coiled-coil-helix-coiled-coil-helix domain-containing protein 10
Organism
hsa  Homo sapiens (human)
Disease
H00058  Amyotrophic lateral sclerosis (ALS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    400916 (CHCHD10)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial protein import machinery
  Inner mambrane
   MINOS/MitOS complex
    400916 (CHCHD10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CHCH DUF2076 Cmc1
Motif
Other DBs
NCBI-GeneID: 400916
NCBI-ProteinID: NP_998885
OMIM: 615903
HGNC: 15559
Ensembl: ENSG00000250479
Vega: OTTHUMG00000150736
Pharos: Q8WYQ3(Tbio)
UniProt: Q8WYQ3
Position
22q11.23
AA seq 142 aa AA seqDB search
MPRGSRSAASRPASRPAAPSAHPPAHPPPSAAAPAPAPSGQPGLMAQMATTAAGVAVGSA
VGHVMGSALTGAFSGGSSEPSQPAVQQAPTPAAPQPLQMGPCAYEIRQFLDCSTTQSDLS
LCEGFSEALKQCKYYHGLSSLP
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgcctcggggaagccgcagcgcggcctcccggccagccagccgcccagccgcgccctct
gcccacccgcccgcgcacccaccgccctcggcagccgccccagcccccgccccttcgggc
cagccggggctcatggctcagatggcgaccacggccgcaggggtagccgtgggctcggct
gtgggacacgtcatgggcagcgccctgaccggagccttcagcggggggagctcggagccc
tcccagcctgctgtccagcaggcccccacccccgctgccccccagcccctgcagatgggg
ccctgcgcctacgagatcaggcagttcctggactgttccaccactcagagtgacctgtcc
ctgtgtgagggcttcagcgaggccctgaagcagtgcaagtactaccatggtctgagctcc
ctgccctga

DBGET integrated database retrieval system