KEGG   Homo sapiens (human): 400986Help
Entry
400986            CDS       T01001                                 

Gene name
ANKRD36C
Definition
(RefSeq) ankyrin repeat domain 36C
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: CCDC144C Ank_4 Ank_2 Ank_5 Ank_3 Ank
Motif
Other DBs
NCBI-GeneID: 400986
NCBI-ProteinID: NP_001297083
HGNC: 32946
Ensembl: ENSG00000174501
Vega: OTTHUMG00000155211
Position
2q11.1
AA seq 2144 aa AA seqDB search
MDDKEPKRWPTLRDRLCSDGFLFPQYPIKPYHLKGIHRAVFYRDLEELKFVLLTRYDINK
RDRKERTALHLACATGQPEMVHLLVSRRCELNLCDREDRTPLIKAVQLRQEACATLLLQN
GADPNITDVFGRTALHYAVYNEDTSMIEKLLSYGANIEECSEDEYPPLFLAVSQRKVKMV
EFLLKKKANINAVDYLGRSALIHAVTLGEKDIVILLLQHNIDVFSRDVYGKLAEDYASEA
KNRVIFELIYEYERKKHEELSINSNPVSSQKQPALKATSGKEDSISNIATEIKDGQKSGT
VSSQKQPALKGTSDKNDSVSNTATEIKDEQKSGTVSSQKQPALKDTSDKNDSVSNTATEI
KDEQKSGTVLPAVEQCLNRSLYRPDAVAQPVTEDEFALESEIISKLYIPKRKIISPRSIE
DVLPPVEEAVDRCLYLLDRFAQAVTKDKFALESENISEPYFTNRRTISQQSAEKLDAACG
IDKTENGTLFEDQNVDKEGKALPATGQKANVSPEQPPLFTHTVKDSDHISTRFLGSMDSL
TSSEESSERPPLSTLTLKEADPSSKAAMRRKDSPPPGKVSSQKQPAEKATSDDKDSVSNI
ATEIKEGPISGTVSSQKQPAEKATSDEKDSVSNIATEIKEGQQSGTVSPQKQSAWKVIFK
KKVSLLNIATRITGGGKSGTVSSQKQPPSKATSDKTDSALNIATEIKDGLQCGTAGRRFF
ICNKFSGDADAAGLGHDLRVSSQKQPALKATTDEEDSVSNIATEIKDGEKSGTVSSQKQP
ALKATTDEEDSVLNIATEIKDGEKSETVSSQKQPALKATTDEEDSVSIIATEIKDGEKSG
TVSSRKKPALKATSDEKDSFSNITREKKDGEISRTVTSEKPAGLKATSDEEDSVLNIARG
KEDGEKTRRVSSRKKPALKATSDEKDSFSNITREKKDGETSRTVSSQKPPALKATSDEED
SVLSIAREEKDGEKSRTVSSEQPPGLKATRDEKDSLLNIARGKKHGEKTRRVSSRKKAAL
KATSDEKDSFSNITRERKDGETSRTVSSQKPPALKATSDEEDSVLNIAREKKDGEKSRTV
SSEQPPGLKATRDEKDSLLNIARGKKYGEKTRRVSSRKKAALKATSDEKDSFSNITRERK
DGETSRTVSSQKPPALKATSDEEDSVLNIAREKKDGEKSRTVSSEQPPGLKATRDEKDSL
LNIARGKKHGEKTRRVSSRKKAALKATSDEKDSFSNITRERKDGETSRTVSSQKPPALKA
TGDEEDSVLNIAREKKDGEKSRTVSSEKPSGLKATSDEKDSVLNIARGKKHGEKTRRVSS
HKQPALKATSDKENSVPNMATETKDEQISGTVSSQKQPALKATSDKKDSVSNIPTEIKDG
QQSGTVSSQKQLAWKATSVKKDSVSNIATEIKDGQIRGTVSSQRQPALKATGDEKDSVSN
IAREIKDGEKSGTVSPQKQSAQKVIFKKKVSLLNIATRITGGWKSGTEYPENLPTLKATI
ENKNSVLNTATKMKDVQTSTPAEQDLEMASEGEQKRLEEYENNQPQVKNQIHSRDDLDDI
IQSSQTVSEDGDSLCCNCKNVILLIDQHEMKCKDCVHLLKIKKTFCLCKRLTELKDNHCE
QLRVKIRKLKNKASVLQKRLSEKEEIKSQLKHETLELEKELCSLRFAIQQEKKKRRNVEE
LHQKVREKLRITEEQYRIEADVTKPIKPALKSAEVELKTGGNNSNQVSETDEKEDLLHEN
RLMQDEIARLRLEKDTIKNQNLEKKYLKDFEIVKRKHEDLQKALKRNEETLAETIACYSG
QLAALTDENTTLRSKLEKQRESGQRLETEMQSYRCRLNAALCDHDQSHSSKRDQELAFQG
TVDKCCHLQENLNSHVLILSLQLSKAESKFRVLETELHYTGEALKEKALVFEHVQSELKQ
KQSQMKDIEKMYKSGYNTMEKCIEKQERFCQLKKQNMLLQQQLDDARNKADNQEKAILNI
QARCDARVENLQAECRKHRLLLEEDNKMLVNELNHSKEKKCQYEKEKAEREVAVRQLQQK
QDDVLNKRSATKALLDASSRHCIYLENGMQDSRKKLDQMRSQFQEIQDQLTATIRCTKEM
EGDAQKLEVENVMMRKIIKKQDEQIERFEKILQHSSLMLQVFES
NT seq 6435 nt NT seq  +upstreamnt  +downstreamnt
atggatgacaaggagccgaagaggtggcccaccctcagggaccgcttgtgctcggatggc
ttcttatttccccaataccccattaaaccgtatcatctgaaggggatccacagagctgtc
ttctatcgtgatctggaggaactgaagttcgttctgctcacgcgttatgacatcaataag
agagacaggaaggaaaggaccgccctacatttggcctgtgccactggccaaccggaaatg
gtacatctcctggtgtccagaagatgtgagcttaacctctgcgaccgtgaagacaggaca
cctctgatcaaggctgtacaactgaggcaggaggcttgtgcaactcttctgctgcaaaat
ggcgccgatccaaatattacggatgtctttggaaggactgctctgcactacgctgtgtat
aatgaagatacatccatgatagaaaaacttctttcatatggtgcaaatattgaagaatgc
agcgaggatgaatatccgccactgttccttgctgtgagtcaaagaaaagtgaaaatggtg
gaatttttattaaagaaaaaagcaaatataaatgccgttgattatcttggcagatcagcc
ctcatacatgctgttactcttggagaaaaagatatagtcattcttcttctgcagcacaat
attgatgtgttttctcgagatgtgtatggaaagcttgcagaagattatgccagcgaggct
aagaacagagtcatttttgaactaatttatgaatatgaaagaaagaaacatgaagagctt
tctataaatagcaatccagtgtcttctcagaaacaaccagccttgaaggctacaagtggc
aaggaagattctatctcgaatatagccacagaaataaaggatggacaaaaatctgggaca
gtgtcttctcagaaacaaccggccttgaagggtacaagtgacaagaacgattctgtttcg
aacacagccacagaaataaaagatgaacaaaaatctgggacagtgtcttctcagaaacaa
ccggccttgaaggatacaagtgacaagaacgattctgtttcgaacacagccacagaaata
aaagatgaacaaaaatctgggacagtgcttcctgctgttgaacagtgtttaaacaggagt
ctctacagaccggatgctgttgcacagcctgtgacagaggatgagtttgctttggaatct
gagattatttcaaaactatacatcccaaagagaaagattatttctccacgatctatagaa
gatgtgcttcctcctgttgaagaggctgttgacaggtgtctctacctactggaccgtttt
gcacaggctgtgacaaaggataagtttgctttggaatctgagaatatttcagaaccatac
tttacaaacagaaggactatttctcaacaatctgcagaaaagttagatgctgcatgtggc
attgacaaaacagaaaatggaaccttgtttgaagaccaaaatgttgataaggaaggaaaa
gcactaccagcaactggacaaaaagcaaatgtgtctcctgagcaaccgcctttattcacg
catacggtgaaagacagtgatcacatttcaactagattcttaggaagtatggattcacta
acttccagtgaagaatcttctgagcgacctcctttatccacgcttactctgaaagaggca
gatcccagttcaaaagcagccatgagaaggaaggattcaccacctccaggaaaagtgtct
tctcagaaacaaccagctgagaaggctacaagtgacgacaaagattctgtttcaaatata
gccacagaaataaaggagggaccaatatctgggacagtgtcttctcagaaacaaccagct
gagaaggctacaagtgatgagaaagattctgtttcaaatatagccacagaaataaaggag
ggacaacaatctgggacagtgtctcctcagaaacaatcagcctggaaggttatatttaaa
aagaaagtttctcttttgaatattgccacaagaataacgggcggtgggaaatctggaaca
gtgtcttctcagaaacaaccaccctcaaaggctacaagtgacaagacagattctgctttg
aatatagctacagaaataaaggatggactacaatgtgggacagcaggccggagattcttc
atttgtaataagttctcgggtgacgctgatgctgctggtcttggacatgatcttcgcgtg
tcttctcagaaacaaccagccttgaaggctacaactgacgaggaagattctgtttcgaat
atagccacagaaataaaggatggagaaaaatctgggacagtgtcttctcagaaacaacca
gccttgaaggctacaactgacgaggaagattctgttttgaatatagccacagaaataaag
gatggagaaaaatctgagacagtgtcttctcagaaacaaccagccttgaaggctacaact
gacgaggaagattctgtttcgattatagccacagaaataaaggacggagaaaaatctggg
acagtgtcttctcggaaaaaaccagccttgaaggctacaagtgatgagaaagattctttt
tcgaatataaccagagaaaaaaaggatggagaaatatctaggacagtgacttctgagaaa
ccagcaggcttgaaggctacaagtgacgaggaagattctgttttgaatatagccagagga
aaagaggatggagaaaaaactaggagagtgtcttctcggaaaaaaccagccttgaaggct
acaagtgatgagaaagattctttttcgaatataaccagagaaaaaaaggatggagaaaca
tctaggacagtgtcttctcagaaaccaccagccttgaaggctacaagtgacgaggaagat
tctgttttgagtatagccagagaagaaaaggatggagaaaaatctaggacagtgtcttct
gagcaaccaccaggcttgaaggctacaagagatgagaaagattctcttttgaatatagcc
agaggaaaaaagcatggagaaaaaactaggagagtgtcttctcggaaaaaagcagccttg
aaggctacaagtgatgagaaagattctttttcaaatataaccagagaaagaaaggatgga
gaaacatctaggacagtgtcttctcagaaaccaccagccttgaaggctacaagtgacgag
gaagattctgttttgaatatagccagagaaaaaaaggatggagaaaaatctagaacagtg
tcttcagagcaaccaccaggcttgaaggctacaagagacgagaaagattctcttttgaat
atagccagaggaaaaaagtatggagaaaaaactaggagagtgtcttctcggaaaaaagca
gccttgaaggctacaagtgatgagaaagattctttttcaaatataaccagagaaagaaag
gatggagaaacatctaggacagtgtcttctcagaaaccaccagccttgaaggctacaagt
gacgaggaagattctgttttgaatatagccagagaaaaaaaggatggagaaaaatctaga
acagtgtcttctgagcaaccaccaggcttgaaggctacaagagatgagaaagattctctt
ttgaatatagccagaggaaaaaagcatggagaaaaaactaggagagtgtcttctcggaaa
aaagcagccttgaaggctacaagtgatgagaaagattctttttcaaatataaccagagaa
agaaaggatggagaaacatctaggacagtgtcttctcagaaaccaccagccttgaaggct
acaggtgacgaggaagattctgttttgaatatagccagagaaaaaaaggatggagaaaaa
tctagaacagtgtcttctgagaaaccatcaggcttgaaggctacaagtgacgagaaagat
tctgttttgaatatagccagaggaaaaaagcatggagaaaaaactaggagagtgtcttct
cataaacaaccagccttgaaggctacaagtgacaaggaaaattctgttccgaatatggcc
acagaaacaaaggatgaacaaatatctgggacagtgtcttctcagaaacaaccagccttg
aaggctacaagtgacaagaaagattctgtttcgaatatacccacagaaataaaggatgga
caacaatctggaacagtgtcttctcagaaacaactggcctggaaggctacaagtgtcaag
aaagattctgtttcgaatatagccacagagataaaggatggacaaatacgtgggacagtg
tcttctcagagacaaccagccttgaaggctacaggtgatgagaaagattctgtttcgaat
atagccagagaaataaaggatggagaaaaatctgggacagtgtctcctcagaaacaatcg
gcccagaaggttatatttaaaaagaaagtttctcttttgaatattgccacaagaataacg
ggcggttggaaatctggaacagagtatcctgagaatctgcccaccttgaaggctacaatt
gaaaataaaaattctgttctgaatacagccaccaaaatgaaagatgtacaaacatccaca
ccagcagaacaagacttagaaatggcatcagagggagagcaaaagaggcttgaagaatat
gaaaataaccagccacaggtgaaaaaccaaatacattctagggatgaccttgatgacata
attcagtcatctcaaacagtctcagaggacggtgactcgctttgctgtaattgtaagaat
gtcatattactcattgatcaacatgaaatgaagtgtaaagattgtgttcacctattgaaa
attaaaaagacattttgtttatgtaaaagattaacagaacttaaagataatcactgtgag
caacttagagtaaaaattcgaaaactgaaaaataaggctagtgtactacaaaagagacta
tctgaaaaagaagaaataaaatcgcagttaaagcatgaaacacttgaattggaaaaagaa
ctctgtagtttgagatttgccatacagcaagaaaaaaagaaaagaagaaatgttgaagag
ttgcaccaaaaagttagggaaaagttaagaatcacagaagagcaatataggatagaagct
gatgtgacaaaaccaattaaaccggctctcaaatcagcagaggtggaattgaagacagga
ggaaataattcaaatcaggtttctgaaactgatgaaaaagaagacctgctgcatgaaaac
cgcttgatgcaagatgaaattgccaggctcaggctggaaaaagacacaataaaaaaccaa
aacctggaaaagaaatacttaaaagactttgaaattgtgaaaagaaagcatgaagacctt
caaaaggctctaaaacggaatgaggaaacattagcagaaacgatagcctgttatagtgga
cagcttgctgctctgacggatgaaaacacaacgctccgttctaaactggagaagcaaaga
gagagcgggcaaagactggaaacagaaatgcaatcataccgttgtagactgaatgctgct
ctatgtgatcatgatcaaagtcactcatcaaaaagagaccaagagcttgctttccagggc
acagtagataaatgttgtcatttacaggaaaatttgaattctcatgttctgattctttct
ctgcaactttctaaagctgagagtaagttcagagtcctcgaaactgagctccattacaca
ggagaggctctgaaagaaaaggctttggtttttgaacacgtgcaaagtgagctaaagcaa
aaacagagtcaaatgaaggacattgaaaaaatgtacaaaagtggatacaatacaatggaa
aaatgcatagaaaagcaggaaagattttgtcaactaaaaaaacaaaatatgttgcttcaa
cagcaactggatgatgctcgcaacaaagctgacaatcaagaaaaagcaatacttaatatt
caagccagatgtgatgctagagtagaaaaccttcaagctgagtgcagaaagcaccgtctc
ttactagaagaagacaataaaatgttggtgaatgaattgaatcattcgaaagaaaaaaaa
tgccaatatgaaaaagagaaagcagaaagagaagtagctgtgagacagcttcaacaaaaa
caagatgatgtcttaaacaaacgatcagcaacaaaagctttgctggatgcttcatcgcgt
cactgcatctatttagaaaatgggatgcaggattcaaggaagaaattagaccagatgaga
agtcaatttcaagaaatacaggatcaacttacagctactataagatgtactaaggagatg
gaaggcgacgcacaaaagcttgaagtagaaaatgtcatgatgagaaaaattattaaaaaa
caggatgaacaaattgagcggtttgagaaaatcctgcagcattcaagtttgatgctgcag
gtgtttgagagctag

DBGET integrated database retrieval system