KEGG   Homo sapiens (human): 401115
Entry
401115            CDS       T01001                                 
Symbol
C4orf48, CHR4_55
Name
(RefSeq) chromosome 4 open reading frame 48
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Neuropep_like GPR15L
Other DBs
NCBI-GeneID: 401115
NCBI-ProteinID: NP_001135408
OMIM: 614690
HGNC: 34437
Ensembl: ENSG00000243449
Vega: OTTHUMG00000154503
Position
4:2036554..2043964
AA seq 95 aa
MAPPPACRSPMSPPPPPLLLLLLSLALLGARARAEPAGSAVPAQSRPCVDCHAFEFMQRA
LQDLRKTACSLDARTETLLLQAERRALCACWPAGH
NT seq 288 nt   +upstreamnt  +downstreamnt
atggcccccccgcccgcgtgccggtccccgatgtcaccgccgccgccgccgctgctgctg
ctgctgctgagtctggcgctgctgggcgcccgggcccgcgccgagcccgccgggagtgcc
gtccccgcgcagagccgcccatgcgtggactgccacgccttcgagttcatgcagcgcgcc
ctgcaggacctgcggaagacagcctgcagcctggacgcgcggacggagaccctactgctg
caggcagagcgccgtgccctgtgtgcctgctggccagcggggcactga

DBGET integrated database retrieval system