KEGG   Homo sapiens (human): 401124Help
Entry
401124            CDS       T01001                                 

Gene name
DTHD1
Definition
(RefSeq) death domain containing 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Death ZU5 GD_AH_C DED DUF2314
Motif
Other DBs
NCBI-GeneID: 401124
NCBI-ProteinID: NP_001164171
OMIM: 616979
HGNC: 37261
Ensembl: ENSG00000197057
Vega: OTTHUMG00000160371
Pharos: Q6ZMT9(Tdark)
UniProt: Q6ZMT9
Position
4p14
AA seq 906 aa AA seqDB search
MDMEYMGSGKLGQILKQIWRQNQMLKQALLGDDLCEGAGGATWMATVVFLGQELSSALHQ
LLEHTSGTLRSTCQQLHVLLDKENQCVSRKEIITFIDCLIKITEHLGSTAALLKKEEKEI
CNLCGMHDECTPQQTMSSIQDTKAADIAARGELNVIETATVSPTNGEESHYTNQVQLEKN
KTHMSSALVEKENNTSLNGRVLGQEESQNKMFPDNAENEDDKQIEHMTVENINGNREETH
GIIQTTETEIQETSESPREEMTTSSIICDISKKYINSTLPNDSENIKHKNNIMEKEYLDV
LSDVTGPQVSCYITAPSYVLQQLECRIINHMSSLIVGDNEELVSNVITIECSDKEKRVPF
PIGIAIPFTARYRGNYRDIMVKVCDINLQSSYLNPNSLEGMKGGYKGTCASVKVYKLGIF
SVVSCLKKESFTVTKKGLALKSSMDSRISLNYPPGVFTSPVLVQLKIQPVDPALVAHLKA
QQDTFYSVQSTSPLIHIQHPSTYPFQKPVTLFLPCSPYLDKNNLGSEIDHKRRASATINR
ITPSYFNRTKIASIRKPRKNASECLKLLGFRSQDSGWCGLDDVVKTIQSGLVSVELYEHL
ERFIVLHLSSTMDNSHLVTFVKSLEEAMLSTTACIVLSHQKDNPHRIAVLVVPSKDLSQV
LKDLHLEGFGGPPEPSRHFQVREGEQLLLRFTGNIFASSNGKDYGKDYTLIFHLQRKPRL
ELQIKEVDEFGNYSCPHYKGTIVVYKVPKGKIVPNLNQSLVINENHSQLPICKLPLKLPK
HKKLINRPQSTKRVSKDPVEALWDNLLHWLAEELSEENAESLSSTLPLRRSTIQLIKLKN
PDDLTEQIHEFLCFWKKSLPTFTDKLRLLARHLRKIGRSDLAEELKFKWENKVFTEPQQC
FDVAPE
NT seq 2721 nt NT seq  +upstreamnt  +downstreamnt
atggatatggaatacatgggctcaggtaaactgggccaaatattgaagcagatttggaga
caaaaccagatgctaaagcaggcactcttgggtgatgacctttgtgagggggctggtggg
gccacttggatggccactgtggtctttctgggtcaggaactcagcagtgcccttcaccag
ctgctggagcacacctcaggcaccctgcgttccacctgccagcagctgcatgtgctgctt
gacaaagagaatcaatgtgtctcgagaaaagaaatcattactttcatagactgcctcata
aaaataactgaacatttggggagcactgctgcacttctaaagaaagaagaaaaggagatt
tgtaatttatgcggcatgcatgatgaatgtactccacagcagacaatgtcctccattcaa
gataccaaagcagcagacattgctgcaagaggggaactaaatgtcatagaaacagctact
gtttctcccacaaatggagaggaaagtcattacacaaaccaggtccagttagaaaaaaat
aaaacacatatgagttcagcattagtggaaaaagaaaacaatacatcactgaatggacgt
gtactggggcaagaagagtcacagaataaaatgttcccagataatgcagaaaatgaagat
gataaacaaatagaacacatgactgttgagaacataaatggcaacagggaagagactcat
ggcataattcagacaacagagacagaaattcaagagacttcagaaagcccaagagaagag
atgaccacatcctcaataatatgtgatatctccaagaaatatataaatagtactcttccc
aatgattcagagaatataaagcacaagaataacataatggaaaaggagtatcttgatgtg
ctgagtgatgttactggcccccaagtgtcttgttatattacagcaccatcatatgttcta
caacaactagaatgccggataataaatcacatgagttctttaatagtgggtgataatgaa
gagttagttagcaacgtcataactattgaatgctcagataaggaaaagagagttccattt
ccaataggcattgcaattccatttactgcacgttacagaggaaattacagagatatcatg
gtgaaagtgtgtgacataaaccttcaatcaagttacctaaacccaaattcactagaagga
atgaagggaggttataaggggacctgtgcttcagtaaaagtttacaaattgggtatcttt
tctgttgtgtcttgtttaaagaaagagtcgttcacagtaacaaagaaaggcctcgctctt
aagtcaagcatggattcccgaatatccttaaattaccctccaggagtttttacctctcca
gtgctggtgcagttaaagatccaaccagttgacccagctctggtggcacatttaaaagca
cagcaagatactttctactcagtccaatccacaagccctctgattcacattcagcaccca
tcaacttatccttttcagaagccagtcactttgtttttaccttgttctccataccttgat
aaaaacaaccttggttctgagatagatcataaaagaagagcaagtgccacaataaatagg
attacaccttcgtatttcaaccggacaaaaattgcctccataagaaaacctaggaaaaat
gccagtgaatgtttgaaattactgggattcagaagccaagacagtggttggtgtgggctt
gatgatgttgtgaaaaccatacagagcggcttggtatcagttgaattgtatgaacatttg
gagaggtttattgtacttcacctctcttccaccatggacaatagtcatttggttactttt
gtgaaatctttagaggaagccatgctcagcaccactgcctgcatagtactgtctcaccag
aaggacaatccacatagaatagctgttttagtggtgccttccaaagatttaagccaggtg
cttaaggacctgcacttggaagggtttggaggacctccagagccatctcgtcatttccaa
gttcgagaaggagaacaacttcttttaagatttactggaaacatatttgcttcaagcaac
gggaaggattatggaaaagactacacacttatttttcacttgcaaagaaaacctaggctg
gaactccaaatcaaagaagtggacgaatttggaaactatagttgccctcattacaaaggc
accattgtcgtttataaagtacctaaaggaaagatagtccccaacttgaatcaatctctc
gtaattaatgaaaaccattctcagttgccaatttgcaaattaccattgaaattgccaaag
cataagaaattaatcaaccgtccacagagtaccaaaagagtttctaaggatcctgtagaa
gccctttgggataacttgctccattggctggctgaggagctctcagaagaaaatgctgag
tctctttcctcaactctccctctgcgccgtagcaccattcagctcatcaaactcaagaac
cctgatgatctcacagaacagatccacgagtttctttgcttctggaaaaaatcgcttcca
actttcaccgacaaacttcgcctcctggctcgacatctccgcaagattggcaggagtgat
cttgcagaagagctcaaattcaagtgggaaaataaagtgttcactgaaccacagcagtgt
tttgatgtagcccctgagtaa

DBGET integrated database retrieval system