KEGG   Homo sapiens (human): 4012Help
Entry
4012              CDS       T01001                                 

Gene name
LNPEP, CAP, IRAP, P-LAP, PLAP
Definition
(RefSeq) leucyl and cystinyl aminopeptidase
  KO
K01257  cystinyl aminopeptidase [EC:3.4.11.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04614  Renin-angiotensin system
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04614 Renin-angiotensin system
    4012 (LNPEP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    4012 (LNPEP)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.3  cystinyl aminopeptidase
     4012 (LNPEP)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M1
   4012 (LNPEP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N Phytase-like Dynactin
Motif
Other DBs
NCBI-GeneID: 4012
NCBI-ProteinID: NP_005566
OMIM: 151300
HGNC: 6656
Ensembl: ENSG00000113441
Vega: OTTHUMG00000128719
Pharos: Q9UIQ6(Tchem)
UniProt: Q9UIQ6
Structure
PDB: 

Position
5q15
AA seq 1025 aa AA seqDB search
MEPFTNDRLQLPRNMIENSMFEEEPDVVDLAKEPCLHPLEPDEVEYEPRGSRLLVRGLGE
HEMEEDEEDYESSAKLLGMSFMNRSSGLRNSATGYRQSPDGACSVPSARTMVVCAFVIVV
AVSVIMVIYLLPRCTFTKEGCHKKNQSIGLIQPFATNGKLFPWAQIRLPTAVVPLRYELS
LHPNLTSMTFRGSVTISVQALQVTWNIILHSTGHNISRVTFMSAVSSQEKQAEILEYAYH
GQIAIVAPEALLAGHNYTLKIEYSANISSSYYGFYGFSYTDESNEKKYFAATQFEPLAAR
SAFPCFDEPAFKATFIIKIIRDEQYTALSNMPKKSSVVLDDGLVQDEFSESVKMSTYLVA
FIVGEMKNLSQDVNGTLVSIYAVPEKIGQVHYALETTVKLLEFFQNYFEIQYPLKKLDLV
AIPDFEAGAMENWGLLTFREETLLYDSNTSSMADRKLVTKIIAHELAHQWFGNLVTMKWW
NDLWLNEGFATFMEYFSLEKIFKELSSYEDFLDARFKTMKKDSLNSSHPISSSVQSSEQI
EEMFDSLSYFKGSSLLLMLKTYLSEDVFQHAVVLYLHNHSYASIQSDDLWDSFNEVTNQT
LDVKRMMKTWTLQKGFPLVTVQKKGKELFIQQERFFLNMKPEIQPSDTSYLWHIPLSYVT
EGRNYSKYQSVSLLDKKSGVINLTEEVLWVKVNINMNGYYIVHYADDDWEALIHQLKINP
YVLSDKDRANLINNIFELAGLGKVPLKRAFDLINYLGNENHTAPITEALFQTDLIYNLLE
KLGYMDLASRLVTRVFKLLQNQIQQQTWTDEGTPSMRELRSALLEFACTHNLGNCSTTAM
KLFDDWMASNGTQSLPTDVMTTVFKVGAKTDKGWSFLLGKYISIGSEAEKNKILEALASS
EDVRKLYWLMKSSLNGDNFRTQKLSFIIRTVGRHFPGHLLAWDFVKENWNKLVQKFPLGS
YTIQNIVAGSTYLFSTKTHLSEVQAFFENQSEATFRLRCVQEALEVIQLNIQWMEKNLKS
LTWWL
NT seq 3078 nt NT seq  +upstreamnt  +downstreamnt
atggagcccttcaccaatgatcggcttcagctccccaggaatatgattgaaaacagcatg
tttgaggaagaaccagatgtggtggatttagccaaagagccttgtttacatcctctagag
cctgatgaggtggaatatgagccccggggttcccgactgctggtgcggggtcttggtgag
catgagatggaggaggatgaagaggattatgagtcatcagcaaagctgctgggcatgtcc
ttcatgaatagaagctcaggccttcggaacagtgcaactggttacaggcagagcccagat
ggggcttgttcagtaccctctgcaaggaccatggtggtctgtgcttttgtcatcgtggtt
gctgtttctgtaatcatggtgatttacttactgcccagatgtacctttaccaaagaaggc
tgccataaaaaaaaccagtcaattggactaattcagccatttgcaacaaatgggaaattg
tttccatgggcacagatcaggcttcccactgccgttgtgccactacgctatgaactcagc
ctacacccgaacctaacctcgatgacattcaggggttctgtgacaatttcagttcaggct
cttcaggtcacatggaatatcattcttcatagcacaggtcataatatttcaagagtgacc
tttatgtcagcagtttcaagccaagaaaaacaagctgagatcctggaatatgcatatcat
ggacagatcgccattgttgcccccgaagcccttctagcagggcacaattatacgttgaag
atagagtactcggcaaatatatctagttcttattatgggttttatggcttctcctacaca
gatgaaagtaatgagaaaaagtactttgcagcaactcagtttgaacccctggcagcaaga
tctgcttttccttgttttgatgaaccagcatttaaagccacttttatcatcaagatcata
agggatgagcaatacaccgctttatcaaatatgcctaagaagtcatcagtcgttctagat
gatggacttgttcaggatgagttttctgagagtgtgaagatgagcacttacttggttgct
ttcattgtgggagagatgaagaacctgagtcaggacgtaaatggaaccctggtttctata
tatgctgtaccagaaaagattggtcaagttcattatgccttggaaacaactgtgaagctt
cttgagttttttcaaaactactttgaaattcagtacccacttaagaaattggatttggtg
gctattcctgactttgaagcaggagcaatggaaaattggggtttgctcaccttccgagag
gagacacttctgtatgacagtaacacttcttcaatggcggatagaaagctggtgactaaa
atcattgctcatgagctggcccaccagtggtttggcaatctggtaacaatgaagtggtgg
aatgacctatggctaaatgaaggttttgccactttcatggagtatttctctttggaaaaa
atattcaaagagctttctagttatgaagatttcttagatgctcgatttaaaaccatgaag
aaagattccttaaattcatctcatccaatatcatcatctgttcagtcttcagaacaaatt
gaagaaatgtttgattctctttcctattttaagggatcttctctcttgttgatgttgaaa
acttaccttagtgaagatgtgtttcaacatgctgttgtcctttacctgcataatcacagc
tatgcatctattcaaagtgatgatctgtgggatagttttaatgaggtcacaaaccaaaca
ctagatgtaaagagaatgatgaaaacctggaccctgcagaaaggatttcctttagtgact
gttcaaaagaaaggaaaggaactttttatacaacaagagagattctttttaaatatgaag
cctgaaattcagccttcagatacaagctacctgtggcatattccactatcctatgtcact
gaaggaagaaattattcaaaatatcaatcggtatcattactggataagaaatcaggtgtc
atcaatcttacagaagaagtgctgtgggtcaaagtgaatataaacatgaatggttattat
attgtacactatgcagatgatgattgggaagcactaatccatcagttgaaaataaatcct
tatgttctgagtgacaaagaccgagccaaccttatcaacaacatctttgaacttgcaggc
ctaggcaaggtacctctcaagagggcctttgatttgattaattatcttggaaatgagaac
catactgcacccatcaccgaagccctgtttcagacagacctcatctataacctccttgaa
aaactgggatacatggatctggcctcaagactggtgactagggtatttaaattacttcaa
aaccaaattcaacaacaaacttggactgatgagggcactccatctatgcgagagcttcgg
tcagccctgctagagtttgcttgcacccacaacctggggaactgctctactactgccatg
aaactgtttgatgactggatggcatccaatggaactcaaagcctacctactgatgtcatg
acaactgtgttcaaagttggagcaaaaactgacaaaggctggtcattccttttgggcaaa
tacatttctataggctctgaagcagagaagaacaaaatactagaagcacttgccagctca
gaggatgtgcggaagctttactggttaatgaaaagtagcctgaatggagataacttccga
acacagaagctgtcttttatcattagaacagtgggtcgacattttcctggacacttactg
gcatgggattttgtcaaagagaactggaataagcttgtacagaagttccctctggggtcc
tataccatacaaaatattgttgctggatcaacttacctgttttcaacaaagacacattta
tctgaggttcaggcattctttgaaaatcagtcagaggcaaccttccggcttcgttgtgtc
caggaggctttggaagtcattcagttgaatatccagtggatggagaagaacctcaaaagt
ctcacatggtggctgtag

DBGET integrated database retrieval system