KEGG   Homo sapiens (human): 401207
Entry
401207            CDS       T01001                                 
Symbol
C5orf63, YDR286C
Name
(RefSeq) chromosome 5 open reading frame 63
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Glrx-like Thioredoxin_2 Glutaredoxin
Other DBs
NCBI-GeneID: 401207
NCBI-ProteinID: NP_001157951
HGNC: 40051
Ensembl: ENSG00000164241
Pharos: A6NC05(Tdark)
UniProt: A6NC05
Position
5:complement(127042562..127073502)
AA seq 138 aa
MLWFQGNSMQLARSSFGLFLRNCSASKTTLPVLTLFTKDPCPLCDEAKEVLKPYENRQPY
KDQKLPGTRRRRSPSSPSHPHMASQSGKRYNLTLNQVLSFDYDMGLDAPKTISSDCGAFY
CLRMFKSPDMTCCFYPKQ
NT seq 417 nt   +upstreamnt  +downstreamnt
atgctctggtttcaaggaaatagcatgcaacttgccagatcctcctttggactcttcttg
agaaattgctctgcctctaagacaactctgcctgtgttgaccttattcacaaaggaccca
tgccccctttgtgatgaagccaaggaagtactcaagccttatgaaaacaggcaaccctac
aaggatcagaagctgccaggaacaaggagaagacgctccccttcctcaccttcccacccc
cacatggcttctcagtcggggaaaagatacaacttaactttaaaccaagtcttaagtttt
gattatgacatgggattagatgcaccaaaaacaatttcaagtgactgtggggcattctat
tgcctgagaatgttcaagagtcctgatatgacctgttgtttttatcctaaacagtga

DBGET integrated database retrieval system