KEGG   Homo sapiens (human): 401258
Entry
401258            CDS       T01001                                 

Gene name
RAB44, RASD3, RASL13, dJ431A14.3
Definition
(RefSeq) RAB44, member RAS oncogene family
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Ras Roc Arf Gtr1_RagA MMR_HSR1 EF-hand_8 SRPRB GTP_EFTU EF-hand_7 FAM184 CAGE1 THOC7 FeoB_N T4SS Laminin_II
Other DBs
NCBI-GeneID: 401258
NCBI-ProteinID: NP_001244286
HGNC: 21068
Ensembl: ENSG00000255587
Vega: OTTHUMG00000016308
UniProt: Q7Z6P3
Position
6p21.2
AA seq 1021 aa
METGQRTSRKVRKLGSNRRRQTREPADGEGAAVAPEPESWSSQAAAELQAFFQDCGAKER
GFVTREDLAVAKFSFLGSKEESEMIFDWVDVERKGHLSLEEFSSGLKNIFGSSQSPHRLR
RRKPLPSKRVSATTSFPALEEADAEEKEAFLAFMEQLGTGHLLPKQMEIWQLWGQLRQEE
PQLAGNLAGFLAKMTSRLQEAQADKEALELTLRKRDSDHHREVQQLYEEMEQQIRQEKQQ
LQAESDSRGLALTSQMQDVLEAKEREVQRLAEGQRELEAQLSHLRSTHQEAASENQQLQE
AKRDLAGRLEEVRGQLQVTRGRLDAARGRVSWQVEEKLSFPGAGEKTPDPQAASPEEAPL
PGLFGDNDDWDQLLSNFGSPPHGALQLCWSPPPTPRATSGPQTPRVVRQISISEPQAFLF
GQEPSSDPDGAPRTPPGVTFSAKDNKGVDPHEQDIRAEQPVEPHDPDPNQEPGSTPEGRL
LWGLSGSLVAPAFKVLIPLEDGPPPPANSPPPQAPAGSSKQIQASDPDDKGPGSWAPPSG
AQPGAGAGPQEPTQTPPTMTERETQPGPSPTTALTGVGPAKPPRQRDALQQDLHATGSEP
RLGTQRARALTLGPAEPFQGLEFVGPVPTERLEQGQAGPAVQEGLPEGLREAHGQVLGLG
ELSAFPHQELEEEPRSEEGKQEGRGGQDLSSEQSEQSVEAHGLETAHSELPQQDSLLVSL
PSATPQAQVEAEGPTPGKSAPPRGSPPRGAQPGAGAGPQEPTQTPPTMAEQEAQPRPSLT
TAHAEEQGPPHSREPRAESRLEDPGMDSREAGLTPSPGDPMAGGGPQANPDYLFHVIFLG
DSNVGKTSFLHLLHQNSFATGLTATVGVDFRVKTLLVDNKCFVLQLWDTAGQERYHSMTR
QLLRKADGVVLMYDITSQESFAHVRYWLDCLQDAGSDGVVILLLGNKMDCEEERQVSVEA
GQQLAQELGVYFGECSAALGHNILEPVVNLARSLRMQEEGLKDSLVKVAPKRPPKRFGCC
S
NT seq 3066 nt   +upstreamnt  +downstreamnt
atggagactggacagagaacatctcgaaaagtccggaagctgggctccaaccggcggcgg
cagacaagagagccagctgatggtgaaggcgctgcagtggccccagagccagagtcttgg
tcctctcaggcagcggcagaactgcaggccttcttccaggactgtggtgccaaggagagg
ggctttgtcacccgcgaggacctggcggtggccaagttcagcttcctgggcagcaaggaa
gagtcagagatgatcttcgactgggtggatgtggagcggaagggacacctgtcccttgaa
gaattcagctctggactcaaaaacatctttggctccagccagagcccccacaggctccgc
agaaggaagccactgccctctaagcgggtatctgctaccaccagcttcccagctctggag
gaggcggatgctgaggagaaggaggcgttccttgccttcatggagcagctggggactgga
cacttacttcccaagcagatggaaatctggcaactgtgggggcagctgcggcaggaggag
ccccagctggcaggcaacctggcaggctttctggccaagatgaccagccgcctgcaggag
gcccaggcggacaaggaggccctggagctgaccctgaggaagcgtgactctgaccaccac
cgcgaggtccagcagctctatgaggagatggagcagcagatccgccaggagaagcagcag
ctgcaggctgagagcgactctcggggcctggccctcacctcccagatgcaggacgtccta
gaggccaaggagcgcgaggtgcagcgactagctgagggccagagggagctggaggcccag
ctctcccacctcaggagcacacatcaggaggctgcctcagagaaccagcagctgcaggag
gccaagcgtgacctggctgggcggctggaggaggtgcgggggcagctgcaggtgaccagg
gggcgcctggacgccgccaggggccgggtgtcctggcaggtggaggagaaactgagtttt
cctggagcgggtgagaagaccccagaccctcaggctgcctcccctgaggaggcccccctg
cctgggctatttggggacaacgatgactgggaccagctactgagcaactttggcagccct
ccgcacggagccctgcagctctgctggagcccgcccccgaccccaagagccacctcaggc
ccccagacaccccgtgtggtcaggcagatctccatctcggagccacaggcttttctattt
ggtcaggagccatcttcagatccagatggggctccaaggaccccacctggggtgactttc
agcgccaaggacaataaaggagtggacccacatgagcaggacattagagcagagcagcct
gttgaaccgcacgacccggaccccaaccaggagccagggtccacacccgagggccgcctc
ctctggggtctctcaggaagcctggtggcacctgcattcaaagtgctcattcctttggag
gatgggccccctccccctgcgaactctccccctccccaggccccagctgggtccagcaaa
cagatccaggcctcagacccagatgacaagggccctgggtcttgggctcctcccagcggg
gctcagcctggggctggagcaggaccccaggaacccacacaaacccctcccaccatgact
gagcgggaaacccagcccggaccctcacccacaactgccctcacaggagtgggcccagcc
aagccgcccaggcagagagatgccctccagcaggacctgcatgccactggctctgagcca
agactggggacccagagggctagagccctcaccctggggccagctgagcccttccagggc
ctggaatttgtgggtccggtgcccacagagaggctggagcagggccaggcgggcccagcg
gtgcaggagggccttcctgaggggctaagagaagctcatggccaggtccttgggctgggt
gagctgtctgccttcccccaccaggagctggaagaggaacccaggtctgaggaaggaaaa
caagagggcagaggtgggcaggacctcagttcagagcagtcagagcagtcggttgaggct
cacggcctagaaactgcgcattcggaactcccccagcaagactctctgcttgtttctctc
ccatctgccacaccacaggctcaggtggaagcagaaggccccactcctggaaaatcggca
cctccaaggggctctcctcccaggggggctcagcctggggctggagcaggaccccaggaa
cccacgcaaacccctcccaccatggctgagcaggaagcccaacccaggccatccctcacg
actgctcacgcagaagaacaaggcccgcctcactccagggaaccaagggcagagagcagg
cttgaagatccaggaatggactccagggaagctgggctgaccccatccccgggagacccc
atggctggagggggaccccaggccaaccctgattacctcttccatgtcatctttctggga
gactccaacgtgggcaaaacatccttcctgcacctgctgcaccagaattctttcgccacc
ggattgacagctaccgtgggagtagattttcgggtcaaaaccttgctggtggacaacaag
tgctttgtgctgcagctctgggacacagctggccaagagaggtaccacagtatgacgcga
cagctgctccgcaaggctgacggggtggtgctcatgtacgacatcacctcccaggagagc
tttgcccacgtgcgctactggctagactgtctccaggatgcagggtcggatggggtggtc
atccttctcctgggaaacaagatggactgtgaggaggaacggcaagtgtccgtggaagct
gggcagcaactggcccaggaactgggggtctattttggggagtgcagtgccgccttgggt
cacaacatcctggagcctgtagtaaacctggccaggtcactcaggatgcaagaagaaggc
ctgaaggactcgctggtgaaggtggcccccaagaggccgcccaagagattcggctgttgc
tcctga

DBGET integrated database retrieval system