KEGG   Homo sapiens (human): 401387Help
Entry
401387            CDS       T01001                                 

Gene name
LRRD1
Definition
(RefSeq) leucine rich repeats and death domain containing 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 LRR_4 Death
Motif
Other DBs
NCBI-GeneID: 401387
NCBI-ProteinID: NP_001155000
HGNC: 34300
Ensembl: ENSG00000240720
Vega: OTTHUMG00000155861
Pharos: A4D1F6(Tdark)
UniProt: A4D1F6
Position
7q21.2
AA seq 860 aa AA seqDB search
MSEKEGMSEVLEDTISQFRKESRSQSMKEPGFIKETSNLINEASDYLEGKSSNQIYETHP
RQNTLESTSSSGRKSKRNEEQKKNLQFSETSTRTGTSQSLSSLTGRTAEYQALVNFLSHE
TVGEVSPQVSEENQKQLGLGADNFTVNLEAKGLQEFPKDILKIKYVKYLYLDKNQIKTFQ
GADSGDLLGLEILSLQENGLSSLPSEIQLLHNLRILNVSHNHISHIPKEISQLGNIRQLF
FYNNYIENFPSDLECLGNLEILSLGKNKLRHIPDTLPSLKTLRVLNLEYNQLTTFPKALC
FLPKLISLDLTGNLISSLPKEIRELKNLETLLMDHNKLTFLAVEIFQLLKIKELQLADNK
LEVISHKIENFRELRILILDKNLLKNIPEKISCCAMLECLSLSDNKLTELPKYIHKLNNL
RKLHVNRNNMVKITDCISHLNNICSLEFSGNIITDVPIEIKNCQKIIKIELSYNKIMYFP
LGLCALDSLYYLSVNGNYISEIPVDISFSKQLLHLELSENKLLIFSEHFCSLINLKYLDL
GKNQIKKIPASISNMISLHVLILCCNKFETFPRELCTLENLQVLDLSENQLQKISSDICN
LKGIQKLNFSSNQFIHFPIELCQLQSLEQLNISQIKGRKLTRLPGELSNMTQLKELDISN
NAIREIPRNIGELRNLVSLHAYNNQISYLPPSLLSLNDLQQLNLSGNNLTALPSAIYNIF
SLKEINFDDNPLLRPPVEICKGKQLYTIARYLQRADERDEKILEKIFKIVANNITETNFE
FLCQKLNLANSETDMPTKSTVSLSERAHQALVIWKTQSNKLSLTAAALRDQLIRALTMIG
AYEIMDKITALNLFTRAIKF
NT seq 2583 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaaaggagggtatgtcagaagtgctagaggatactattagtcaatttaggaaa
gaatctagatcacagtcaatgaaggagcctggctttattaaagaaacatcaaatttgata
aacgaagcttctgattacctggaagggaaatcttctaaccagatttatgaaacacatcct
agacagaatacattagagtcaacatcttcctctggaaggaagtctaagagaaatgaagaa
caaaagaaaaatcttcaattttctgaaacaagcactagaacaggaacttcacagagttta
tcatcactaactgggaggactgcagaatatcaggctttggttaacttcctatctcatgaa
acagtaggagaagttagtccacaagtctctgaagaaaatcagaaacaacttggcctaggg
gcagataactttacagttaaccttgaggccaagggtttacaggaatttcctaaggacatt
ttaaaaatcaaatatgtaaaatatctatatttagacaagaatcaaatcaaaacatttcaa
ggggcagactcaggtgatctgttaggacttgaaattctatccctgcaagaaaatggatta
tcatcacttccatctgaaattcagttacttcataatttaaggatattaaatgtcagtcat
aaccacatatcacatatacctaaagaaatatctcagcttgggaatatcagacaactcttt
ttttataacaattacattgaaaattttccttctgacttagaatgtcttggaaacttggaa
attttaagtttgggtaaaaataagttaagacatataccagatactctgcctagtttaaaa
accttgagggttctcaatttggaatataatcagttaacaacatttcctaaagctctctgc
ttccttccaaagttaatttcactagaccttactggaaacctaataagcagtttgccaaaa
gaaattagagagcttaaaaatttagaaacacttttaatggatcacaataagcttaccttt
ctggctgtagaaatttttcagttactcaaaataaaagaactccaactggccgacaataaa
ttggaagttatttcacacaaaattgagaatttcagggaacttaggattcttatacttgat
aaaaatttattgaaaaatataccagagaaaatatcttgctgtgcaatgttggaatgcctt
agtcttagtgataataaattaacagaactccctaagtacatccataagcttaacaattta
agaaaactccatgtaaacagaaataatatggtaaaaataactgactgtatctcacatctt
aataacatatgcagtctagaattttcaggaaacataatcacagatgttcccattgaaata
aaaaactgccaaaaaataattaaaattgaattgagttataacaaaataatgtattttcca
ttgggactgtgtgctttagattctctttattatttgagtgttaatggaaattatatttca
gaaatacctgtggatatatctttcagtaaacaactgcttcatttagaattgagtgaaaac
aaactcctcatattttctgagcacttttgttctcttattaatcttaaatacctggatctt
ggtaaaaaccaaataaagaaaattccagcatcaatttctaatatgatatcactccacgta
cttattttatgctgtaataaatttgaaactttccctagagaattgtgtactttagaaaat
ttgcaagtacttgatctttcggaaaaccaattacagaaaatctcttcagacatctgtaat
ttaaaaggaatccagaaattaaacttctcaagcaatcaatttatacattttcctattgaa
ctgtgccaacttcaatcactggaacagctgaatataagtcagataaaagggagaaagcta
acaagacttccaggagagctatctaatatgactcaacttaaagaacttgatatctcaaat
aatgcaatcagagagattccaagaaatataggagaattgagaaatttggttagtttacat
gcatacaataatcaaataagttatcttccaccatctttgctatctttaaatgatctgcag
caactaaacctgagtggaaataatctgacagctctacctagtgctatctacaatattttt
tcactgaaggagataaattttgatgacaaccctttgctgagacctccagtggaaatctgt
aaaggaaaacagttgtatactattgcacgctatctacagagggcagatgaaagagatgag
aaaattttagagaagatattcaagatagttgccaacaacatcactgaaaccaattttgaa
tttttatgtcaaaaactaaacctggcaaactcagaaactgatatgcctacaaagagcact
gtttcattaagtgagagagcccaccaagcacttgttatatggaaaacacaaagtaacaag
ttatcactaactgctgctgctttaagagatcaactaattcgagcactaactatgatagga
gcatatgaaattatggacaaaataacagctttaaatctttttacgcgtgcaattaaattc
taa

DBGET integrated database retrieval system