KEGG   Homo sapiens (human): 401427Help
Entry
401427            CDS       T01001                                 

Gene name
OR2A7, HSDJ0798C17, OR2A21
Definition
(RefSeq) olfactory receptor family 2 subfamily A member 7
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    401427 (OR2A7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    401427 (OR2A7)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Olfactory
    401427 (OR2A7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 401427
NCBI-ProteinID: NP_001005328
HGNC: 8234
Ensembl: ENSG00000243896
Vega: OTTHUMG00000158002
Pharos: Q96R45(Tdark)
UniProt: Q96R45 A0A126GWD8
Position
7q35
AA seq 310 aa AA seqDB search
MGDNITSITEFLLLGFPVGPRIQMLLFGLFSLFYVFTLLGNGTILGLISLDSRLHAPMYF
FLSHLAVVDIAYACNTVPRMLVNLLHPAKPISFAGRMMQTFLFSTFAVTECLLLVVMSYD
LYVAICHPLRYLAIMTWRVCITLAVTSWTTGVLLSLIHLVLLLPLPFCRPQKIYHFFCEI
LAVLKLACADTHINENMVLAGAISGLVGPLSTIVVSYMCILCAILQIQSREVQRKAFCTC
FSHLCVIGLFYGTAIIMYVGPRYGNPKEQKKYLLLFHSLFNPMLNPLICSLRNSEVKNTL
KRVLGVERAL
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgggggacaatataacatccatcacagagttcctcctactgggatttcccgttggccca
aggattcagatgctcctctttgggctcttctccctgttctacgtcttcaccctgctgggg
aacgggaccatactggggctcatctcactggactccagactgcacgcccccatgtacttc
ttcctctcacacctggcggtcgtcgacatcgcctacgcctgcaacacggtgccccggatg
ctggtgaacctcctgcatccagccaagcccatctcctttgcgggccgcatgatgcagacc
tttctgttttccacttttgctgtcacagaatgtctcctcctggtggtgatgtcctatgat
ctgtacgtggccatctgccaccccctccgatatttggccatcatgacctggagagtctgc
atcaccctcgcggtgacttcctggaccactggagtccttttatccttgattcatcttgtg
ttacttctacctttacccttctgtaggccccagaaaatttatcactttttttgtgaaatc
ttggctgttctcaaacttgcctgtgcagatacccacatcaatgagaacatggtcttggcc
ggagcaatttctgggctggtgggacccttgtccacaattgtagtttcatatatgtgcatc
ctctgtgctatccttcagatccaatcaagggaagttcagaggaaagccttctgcacctgc
ttctcccacctctgtgtgattggactcttttatggcacagccattatcatgtatgttgga
cccagatatgggaaccccaaggagcagaagaaatatctcctgctgtttcacagcctcttt
aatcccatgctcaatccccttatctgtagtcttaggaactcagaagtgaagaatactttg
aagagagtgctgggagtagaaagggctttatga

DBGET integrated database retrieval system