KEGG   Homo sapiens (human): 4015Help
Entry
4015              CDS       T01001                                 

Gene name
LOX, AAT10
Definition
(RefSeq) lysyl oxidase
  KO
K00277  protein-lysine 6-oxidase [EC:1.4.3.13]
Organism
hsa  Homo sapiens (human)
Disease
H00801  Familial thoracic aortic aneurysm and dissection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    4015 (LOX)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.13  protein-lysine 6-oxidase
     4015 (LOX)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lysyl_oxidase CARDB BsuPI
Motif
Other DBs
NCBI-GeneID: 4015
NCBI-ProteinID: NP_002308
OMIM: 153455
HGNC: 6664
Ensembl: ENSG00000113083
Vega: OTTHUMG00000128914
Pharos: P28300(Tbio)
UniProt: P28300 D0PNI2
Position
5q23.1
AA seq 417 aa AA seqDB search
MRFAWTVLLLGPLQLCALVHCAPPAAGQQQPPREPPAAPGAWRQQIQWENNGQVFSLLSL
GSQYQPQRRRDPGAAVPGAANASAQQPRTPILLIRDNRTAAARTRTAGSSGVTAGRPRPT
ARHWFQAGYSTSRAREAGASRAENQTAPGEVPALSNLRPPSRVDGMVGDDPYNPYKYSDD
NPYYNYYDTYERPRPGGRYRPGYGTGYFQYGLPDLVADPYYIQASTYVQKMSMYNLRCAA
EENCLASTAYRADVRDYDHRVLLRFPQRVKNQGTSDFLPSRPRYSWEWHSCHQHYHSMDE
FSHYDLLDANTQRRVAEGHKASFCLEDTSCDYGYHRRFACTAHTQGLSPGCYDTYGADID
CQWIDITDVKPGNYILKVSVNPSYLVPESDYTNNVVRCDIRYTGHHAYASGCTISPY
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgcgcttcgcctggaccgtgctcctgctcgggcctttgcagctctgcgcgctagtgcac
tgcgcccctcccgccgccggccaacagcagcccccgcgcgagccgccggcggctccgggc
gcctggcgccagcagatccaatgggagaacaacgggcaggtgttcagcttgctgagcctg
ggctcacagtaccagcctcagcgccgccgggacccgggcgccgccgtccctggtgcagcc
aacgcctccgcccagcagccccgcactccgatcctgctgatccgcgacaaccgcaccgcc
gcggcgcgaacgcggacggccggctcatctggagtcaccgctggccgccccaggcccacc
gcccgtcactggttccaagctggctactcgacatctagagcccgcgaagctggcgcctcg
cgcgcggagaaccagacagcgccgggagaagttcctgcgctcagtaacctgcggccgccc
agccgcgtggacggcatggtgggcgacgacccttacaacccctacaagtactctgacgac
aacccttattacaactactacgatacttatgaaaggcccagacctgggggcaggtaccgg
cccggatacggcactggctacttccagtacggtctcccagacctggtggccgacccctac
tacatccaggcgtccacgtacgtgcagaagatgtccatgtacaacctgagatgcgcggcg
gaggaaaactgtctggccagtacagcatacagggcagatgtcagagattatgatcacagg
gtgctgctcagatttccccaaagagtgaaaaaccaagggacatcagatttcttacccagc
cgaccaagatattcctgggaatggcacagttgtcatcaacattaccacagtatggatgag
tttagccactatgacctgcttgatgccaacacccagaggagagtggctgaaggccacaaa
gcaagtttctgtcttgaagacacatcctgtgactatggctaccacaggcgatttgcatgt
actgcacacacacagggattgagtcctggctgttatgatacctatggtgcagacatagac
tgccagtggattgatattacagatgtaaaacctggaaactatatcctaaaggtcagtgta
aaccccagctacctggttcctgaatctgactataccaacaatgttgtgcgctgtgacatt
cgctacacaggacatcatgcgtatgcctcaggctgcacaatttcaccgtattag

DBGET integrated database retrieval system