KEGG   Homo sapiens (human): 401505Help
Entry
401505            CDS       T01001                                 

Gene name
TOMM5, C9orf105, Tom5, bA613M10.3
Definition
(RefSeq) translocase of outer mitochondrial membrane 5
  KO
K17773  mitochondrial import receptor subunit TOM5
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    401505 (TOMM5)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    401505 (TOMM5)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial protein import machinery
  Outer membrane
   Transporter outer membrane (TOM) complex
    401505 (TOMM5)
Transporters [BR:hsa02000]
 Other transporters
  Primary active transporters [TC:3]
   401505 (TOMM5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tom5
Motif
Other DBs
NCBI-GeneID: 401505
NCBI-ProteinID: NP_001001790
OMIM: 616169
HGNC: 31369
Ensembl: ENSG00000175768
Vega: OTTHUMG00000019923
Pharos: Q8N4H5(Tdark)
UniProt: Q8N4H5
Position
9p13.2
AA seq 51 aa AA seqDB search
MFRIEGLAPKLDPEEMKRKMREDVISSIRNFLIYVALLRVTPFILKKLDSI
NT seq 156 nt NT seq  +upstreamnt  +downstreamnt
atgttccggattgagggcctcgcgccgaagctggacccggaggagatgaaacggaagatg
cgcgaggatgtgatctcctccatacggaactttctcatctacgtggccctcctgcgagtc
actccatttatcttaaagaaattggacagcatatga

DBGET integrated database retrieval system