KEGG   Homo sapiens (human): 401541
Entry
401541            CDS       T01001                                 

Gene name
CENPP, CENP-P
Definition
(RefSeq) centromere protein P
  KO
K11508  centromere protein P
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    401541 (CENPP)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Kinetochore proteins
    Centromere proteins
     401541 (CENPP)
SSDB
Motif
Pfam: CENP-P
Other DBs
NCBI-GeneID: 401541
NCBI-ProteinID: NP_001012267
OMIM: 611505
HGNC: 32933
Ensembl: ENSG00000188312
Vega: OTTHUMG00000020228
Pharos: Q6IPU0(Tbio)
UniProt: Q6IPU0
Position
9q22.31
AA seq 288 aa
MDAELAEVRALQAEIAALRRACEDPPAPWEEKSRVQKSFQAIHQFNLEGWKSSKDLKNQL
GHLESELSFLSTLTGINIRNHSKQTEDLTSTEMTEKSIRKVLQRHRLSGNCHMVTFQLEF
QILEIQNKERLSSAVTDLNIIMEPTECSELSEFVSRAEERKDLFMFFRSLHFFVEWFEYR
KRTFKHLKEKYPDAVYLSEGPSSCSMGIRSASRPGFELVIVWRIQIDEDGKVFPKLDLLT
KVPQRALELDKNRAIETAPLSFRTLVGLLGIEAALESLIKSLCAEENN
NT seq 867 nt   +upstreamnt  +downstreamnt
atggacgcagagctggcagaggtgcgcgccttgcaagctgagatcgcggccctgcggcga
gcgtgtgaggacccaccggcgccctgggaagagaagtcccgagtccaaaaatcttttcaa
gccatacaccaattcaatttggaaggatggaagtcttcaaaagatctgaaaaatcagctt
ggacatttagaatcagaactttcatttctaagtacgcttactggcatcaatataagaaat
cactccaagcagacagaagacctaacaagcactgagatgacagaaaagagtattagaaaa
gttctacagagacacagattatcaggaaattgccacatggttacatttcaacttgaattt
cagattctggaaattcagaataaggagagattatcttctgctgttactgacctcaacata
ataatggagcccacagaatgctcagaattaagtgaatttgtgtctagagcagaagagaga
aaagatctgttcatgtttttccgaagcctgcatttttttgtggagtggtttgaatatcgt
aagcgcacgtttaaacatctcaaggaaaagtacccagatgccgtgtacctctcggagggg
ccctcctcctgctccatggggatccgcagcgccagccggccagggtttgaattagtcatt
gtttggaggatacaaatagatgaagatgggaaggtttttccaaagctggatcttctcacc
aaagtcccacagcgagccctggagctggacaagaacagagccatagaaactgctcctctc
agcttccgaaccctggtaggactgcttggaatcgaagctgctctggaaagcctgataaaa
tcgctttgtgcagaggagaacaactag

DBGET integrated database retrieval system