KEGG   Homo sapiens (human): 4016Help
Entry
4016              CDS       T01001                                 

Gene name
LOXL1, LOL, LOXL
Definition
(RefSeq) lysyl oxidase like 1
  KO
K14678  lysyl oxidase-like protein 1 [EC:1.4.3.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    4016 (LOXL1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.-  
     4016 (LOXL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lysyl_oxidase CARDB
Motif
Other DBs
NCBI-GeneID: 4016
NCBI-ProteinID: NP_005567
OMIM: 153456
HGNC: 6665
Ensembl: ENSG00000129038
Vega: OTTHUMG00000137595
Pharos: Q08397(Tbio)
UniProt: Q08397
Position
15q24.1
AA seq 574 aa AA seqDB search
MALARGSRQLGALVWGACLCVLVHGQQAQPGQGSDPARWRQLIQWENNGQVYSLLNSGSE
YVPAGPQRSESSSRVLLAGAPQAQQRRSHGSPRRRQAPSLPLPGRVGSDTVRGQARHPFG
FGQVPDNWREVAVGDSTGMARARTSVSQQRHGGSASSVSASAFASTYRQQPSYPQQFPYP
QAPFVSQYENYDPASRTYDQGFVYYRPAGGGVGAGAAAVASAGVIYPYQPRARYEEYGGG
EELPEYPPQGFYPAPERPYVPPPPPPPDGLDRRYSHSLYSEGTPGFEQAYPDPGPEAAQA
HGGDPRLGWYPPYANPPPEAYGPPRALEPPYLPVRSSDTPPPGGERNGAQQGRLSVGSVY
RPNQNGRGLPDLVPDPNYVQASTYVQRAHLYSLRCAAEEKCLASTAYAPEATDYDVRVLL
RFPQRVKNQGTADFLPNRPRHTWEWHSCHQHYHSMDEFSHYDLLDAATGKKVAEGHKASF
CLEDSTCDFGNLKRYACTSHTQGLSPGCYDTYNADIDCQWIDITDVQPGNYILKVHVNPK
YIVLESDFTNNVVRCNIHYTGRYVSATNCKIVQS
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atggctctggcccgaggcagccggcagctgggggccctggtgtggggcgcctgcctgtgc
gtgctggtgcacgggcagcaggcgcagcccgggcagggctcggaccccgcccgctggcgg
cagctgatccagtgggagaacaacgggcaggtgtacagcttgctcaactcgggctcagag
tacgtgccggccggacctcagcgctccgagagtagctcccgggtgctgctggccggcgcg
ccccaggcccagcagcggcgcagccacgggagcccccggcgtcggcaggcgccgtccctg
cccctgccggggcgcgtgggctcggacaccgtgcgcggccaggcgcggcacccattcggc
tttggccaggtgcccgacaactggcgcgaggtggccgtcggggacagcacgggcatggcc
cgggcccgcacctccgtctcccagcaacggcacgggggctccgcctcctcggtctcggct
tcggccttcgccagcacctaccgccagcagccctcctacccgcagcagttcccctacccg
caggcgcccttcgtcagccagtacgagaactacgaccccgcgtcgcggacctacgaccag
ggtttcgtgtactaccggcccgcgggcggcggcgtgggcgcgggggcggcggccgtggcc
tcggcgggggtcatctacccctaccagccccgggcgcgctacgaggagtacggcggcggc
gaagagctgcccgagtacccgcctcagggcttctacccggcccccgagaggccctacgtg
ccgccgccgccgccgccccccgacggcctggaccgccgctactcgcacagtctgtacagc
gagggcacccccggcttcgagcaggcctaccctgaccccggtcccgaggcggcgcaggcc
catggcggagacccacgcctgggctggtacccgccctacgccaacccgccgcccgaggcg
tacgggccgccgcgcgcgctggagccgccctacctgccggtgcgcagctccgacacgccc
ccgccgggtggggagcggaacggcgcgcagcagggccgcctcagcgtgggcagcgtgtac
cggcccaaccagaacggccgcggtctccctgacttggtcccagaccccaactatgtgcaa
gcatccacttatgtgcagagagcccacctgtactccctgcgctgtgctgcggaggagaag
tgtctggccagcacagcctatgcccctgaggccaccgactacgatgtgcgggtgctactg
cgcttcccccagcgcgtgaagaaccagggcacagcagacttcctccccaaccggccacgg
cacacctgggagtggcacagctgccaccagcattaccacagcatggacgagttcagccac
tacgacctactggatgcagccacaggcaagaaggtggccgagggccacaaggccagtttc
tgcctggaggacagcacctgtgacttcggcaacctcaagcgctatgcatgcacctctcat
acccagggcctgagcccaggctgctatgacacctacaatgcggacatcgactgccagtgg
atcgacataaccgacgtgcagcctgggaactacatcctcaaggtgcacgtgaacccaaag
tatattgttttggagtctgacttcaccaacaacgtggtgagatgcaacattcactacaca
ggtcgctacgtttctgcaacaaactgcaaaattgtccaatcctga

DBGET integrated database retrieval system