KEGG   Homo sapiens (human): 401647Help
Entry
401647            CDS       T01001                                 

Gene name
GOLGA7B, C10orf132, C10orf133, bA451M19.3, bA459F3.4
Definition
(RefSeq) golgin A7 family member B
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Erf4
Motif
Other DBs
NCBI-GeneID: 401647
NCBI-ProteinID: NP_001010917
OMIM: 614189
HGNC: 31668
Ensembl: ENSG00000155265
Vega: OTTHUMG00000018869
Pharos: Q2TAP0(Tdark)
UniProt: Q2TAP0 Q6ZUQ1
Position
10q24.2
AA seq 167 aa AA seqDB search
MATEVHNLQELRRSASLATKVFIQRDYSDGTICQFQTKFPPELDSRIERQLFEETVKTLN
GFYAEAEKIGGSSYLEGCLACATAYFIFLCMETHYEKVLKKISRYIQEQNEKIFAPRGLL
LTDPVERGMRVIEISIYEDRCSSGSSSSGSSSGSGSSSGGGGGAGAR
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgaggtccacaatctgcaggagctccggcgaagtgcctcactggccaccaag
gtctttatccagagagactacagcgatgggaccatctgtcagttccagaccaaattcccc
ccagagctggacagccggatcgagcggcagctctttgaagagactgtgaagaccctcaac
ggattttacgcagaggctgagaagattgggggcagctcctacctcgagggctgcctggcc
tgcgccacggcctacttcatcttcctctgcatggagacccactatgagaaggttctcaag
aagatttcccgctacatccaggagcagaatgagaagatctttgcacctcgaggcctccta
cttacagaccctgtggagcgtgggatgagggttattgagatctccatctacgaggaccgg
tgcagcagtggcagctccagcagcggcagcagcagcggcagtggcagcagcagcggtggg
ggtggtggggcgggggcccggtga

DBGET integrated database retrieval system