KEGG   Homo sapiens (human): 401663Help
Entry
401663            CDS       T01001                                 

Gene name
OR51H1, OR51H1P
Definition
(RefSeq) olfactory receptor family 51 subfamily H member 1
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    401663 (OR51H1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    401663 (OR51H1)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Olfactory
    401663 (OR51H1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 401663
NCBI-ProteinID: NP_001335220
HGNC: 14833
Vega: OTTHUMG00000066512
UniProt: Q8NH63 A0A126GVH7
Position
11p15.4
AA seq 302 aa AA seqDB search
MTNLNASQANHRNFILTGIPGTPDKNPWLAFPLGFLYTLTLLGNGTILAVIKVEPSLHEP
TYYFLSILALTDVSLSMSTLPSMLSIYWFNAPQIVFDACIMQMFFIHVFGIVESGVLVSM
AFDRFVAIRNPLHYVSILTHDVIRKTGIAVLTRAVCVVFPVPFLIKCLPFCHSNVLSHSY
CLHQNMMRLACASTRINSLYGLIVVIFTLGLDVLLTLLSYVLTLKTVLGIVSRGERLKTL
STCLSHMSTVLLFYVPFMGAASMIHRFWEHLSPVVHMVMADIYLLLPPVLNPIVYSVKTK
QI
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgacgaacttgaatgcatcacaggccaaccaccgtaacttcattctgacaggtatccca
ggaacgccagacaagaacccatggttggcctttcccctgggatttctctacacactcaca
ctcctgggaaatggtaccatcctagctgtcatcaaggtggagccaagtctccatgagccc
acgtattacttcctttctatcttggctctcactgacgttagtctctccatgtccaccttg
ccctccatgctcagcatctactggtttaatgcccctcagattgtttttgatgcatgcatc
atgcagatgttcttcatccatgtatttggaatagtagaatcaggagtcctagtgtccatg
gcctttgacagatttgtggccatccgaaacccattacactatgtttccatcctcactcac
gatgttattcgaaagactggaatagctgtcctcacccgggcagtctgtgtggtattccct
gtgcccttccttataaagtgcctacccttctgccattccaatgtcttgtctcattcatac
tgtcttcaccaaaacatgatgcggctagcttgtgccagcacccgcatcaacagcctctac
ggcctcatcgtcgtcatcttcacactggggctcgatgttctcctcactctactgtcttat
gtactcaccctgaagactgtgctgggcattgtctccagaggtgaaaggctgaaaaccctc
agcacatgcctctctcacatgtctaccgtgctcctcttctatgttccttttatgggtgct
gcctccatgatccacagattttgggagcatttatcaccagtagtgcacatggtcatggct
gatatatacctactgctcccgcctgtgctaaaccccattgtctacagtgtgaagaccaag
caaatttga

DBGET integrated database retrieval system