KEGG   Homo sapiens (human): 401667Help
Entry
401667            CDS       T01001                                 

Gene name
OR51A2
Definition
(RefSeq) olfactory receptor family 51 subfamily A member 2
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    401667 (OR51A2)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    401667 (OR51A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 401667
NCBI-ProteinID: NP_001004748
HGNC: 14764
Ensembl: ENSG00000205496
Vega: OTTHUMG00000066602
Pharos: Q8NGJ7(Tdark)
UniProt: Q8NGJ7 A0A126GWD5
Position
11p15.4
AA seq 313 aa AA seqDB search
MSIINTSYVEITTFFLVGMPGLEYAHIWISIPICSMYLIAILGNGTILFIIKTEPSLHGP
MYYFLSMLAMSDLGLSLSSLPTVLSIFLFNAPETSSSACFAQEFFIHGFSVLESSVLLIM
SFDRFLAIHNPLRYTSILTTVRVAQIGIVFSFKSMLLVLPFPFTLRSLRYCKKNQLSHSY
CLHQDVMKLACSDNRIDVIYGFFGALCLMVDFILIAVSYTLILKTVPGIASKKEELKALN
TCVSHICAVIIFYLPIINLAVVHRFAGHVSPLINVLMANVLLLVPPLMKPIVYCVKTKQI
RVRVVAKLCQWKI
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgtccattatcaacacatcatatgttgaaatcaccaccttcttcttggttgggatgcca
gggctagaatatgcacacatctggatctctatccccatctgcagcatgtatcttattgct
attctaggaaatggcaccattctttttatcatcaagacagagccctccttgcatgggccc
atgtactattttctttccatgttggctatgtcagacttgggtttgtctttatcatctctg
cccactgtgttaagcatcttcctgttcaatgcccctgaaacttcttctagtgcctgcttt
gcccaggaattcttcattcatggattctcagtactggagtcctcagtcctcctgatcatg
tcatttgatagattcctagccatccacaatcctctgagatacacctcaatcctgacaact
gtcagagttgcccaaatagggatagtattctcctttaagagcatgctcctggttcttccc
ttccctttcactttaagaagcttgagatattgcaagaaaaaccaattatcccattcctac
tgtctccaccaggatgtcatgaagttggcctgttctgacaacagaattgatgttatctat
ggcttttttggagcactctgccttatggtagactttattctcattgctgtgtcttacacc
ctgatcctcaagactgtaccgggaattgcatccaaaaaggaggagcttaaggctctcaat
acttgtgtttcacacatctgtgcagtgatcatcttctacctgcccatcatcaacctggcc
gttgtccaccgctttgccgggcatgtctctcccctcattaatgttctcatggcaaatgtt
ctcctacttgtacctccgctgatgaaaccaattgtttattgtgtaaaaactaaacagatt
agagtgagagttgtagcaaaattgtgtcaatggaagatttaa

DBGET integrated database retrieval system