KEGG   Homo sapiens (human): 401993Help
Entry
401993            CDS       T01001                                 

Gene name
OR2T5, OR1-62
Definition
(RefSeq) olfactory receptor family 2 subfamily T member 5
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    401993 (OR2T5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    401993 (OR2T5)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Olfactory
    401993 (OR2T5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 401993
NCBI-ProteinID: NP_001004697
HGNC: 15017
Ensembl: ENSG00000203661
Vega: OTTHUMG00000040481
Pharos: Q6IEZ7(Tdark)
UniProt: Q6IEZ7
Position
1q44
AA seq 315 aa AA seqDB search
MANITRMANHTGKLDFILMGLFRRSKHPALLSVVIFVVFLKALSGNAVLILLIHCDAHLH
SPMYFFISQLSLMDMAYISVTVPKMLLDQVMGVNKVSAPECGMQMFLYLTLAGSEFFLLA
TMAYDRYVAICHPLRYPVLMNHRVCLFLASGCWFLGSVDGFMLTPITMSFPFCRSWEIHH
FFCEVPAVTILSCSDTSLYETLMYLCCVLMLLIPVTIISSSYLLILLTVHRMNSAEGRKK
AFATCSSHLTVVILFYGAAVYTYMLPSSYHTPEKDMMVSVFYTILTPVLNPLIYSLRNKD
VMGALKKMLTVRFVL
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggccaacatcaccaggatggccaaccacactggaaagttggatttcatcctcatggga
ctcttcagacgatccaaacatccagctctacttagtgtggtcatctttgtggttttcctg
aaggcgttgtctggaaatgctgtcctgatccttctgatacactgtgacgcccacctccac
agccccatgtactttttcatcagtcaattgtctctcatggacatggcgtacatttctgtc
actgtgcccaagatgctcctggaccaggtcatgggtgtgaataaggtctcagcccctgag
tgtgggatgcagatgttcctctatctgacactagcaggttcggaatttttccttctagcc
accatggcctatgaccgctacgtggccatctgccatcctctccgttaccctgtcctcatg
aaccatagggtctgtcttttcctggcatcgggctgctggttcctgggctcagtggatggc
ttcatgctcactcccatcaccatgagcttccccttctgcagatcctgggagattcatcat
ttcttctgtgaagtccctgctgtaacgatcctgtcctgctcagacacctcactctatgag
accctcatgtacctatgctgtgtcctcatgctcctcatccctgtgacgatcatttcaagc
tcctatttactcatcctcctcaccgtccacaggatgaactcagcagagggccggaaaaag
gcctttgccacctgctcctcccacctgactgtggtcatcctcttctatggggctgccgtc
tacacctacatgctccccagctcctaccacacccctgagaaggacatgatggtatctgtc
ttctataccatcctcactccggtgctgaaccctttaatctatagtcttaggaataaggat
gtcatgggggctctgaagaaaatgttaactgtgagattcgtcctttag

DBGET integrated database retrieval system