KEGG   Homo sapiens (human): 401994
Entry
401994            CDS       T01001                                 

Gene name
OR14I1, OR5BU1, OR5BU1P
Definition
(RefSeq) olfactory receptor family 14 subfamily I member 1
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    401994 (OR14I1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    401994 (OR14I1)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Olfactory
    401994 (OR14I1)
SSDB
Motif
Pfam: 7tm_4 7tm_1
Other DBs
NCBI-GeneID: 401994
NCBI-ProteinID: NP_001004734
OMIM: 618516
HGNC: 19575
Ensembl: ENSG00000189181
Vega: OTTHUMG00000040378
Pharos: A6ND48(Tdark)
UniProt: A6ND48
Position
1q44
AA seq 311 aa
MDNLTKVTEFLLMEFSGIWELQVLHAGLFLLIYLAVLVGNLLIIAVITLDQHLHTPMYFF
LKNLSVLDLCYISVTVPKSIRNSLTRRSSISYLGCVAQVYFFSAFASAELAFLTVMSYDR
YVAICHPLQYRAVMTSGGCYQMAVTTWLSCFSYAAVHTGNMFREHVCRSSVIHQFFRDIP
HVLALVSCEVFFVEFLTLALSSCLVLGCFILMMISYFQIFSTVLRIPSGQSRAKAFSTCS
PQLIVIMLFLTTGLFAALGPIAKALSIQDLVIALTYTVLPPFLNPIIYSLRNKEIKTAMW
RLFVKIYFLQK
NT seq 936 nt   +upstreamnt  +downstreamnt
atggacaatctcacaaaagtgacagaattcctgctgatggagttttctggtatctgggag
ctgcaggtgctgcacgccgggctgtttctgctgatttatctggcagtgctggtggggaac
ctgctcatcattgcagtcatcactctcgatcagcatcttcacacacccatgtacttcttc
ctgaagaacctctccgttttggatctgtgctacatctcagtcactgtgcctaaatccatc
cgtaactccctgactcgcagaagctccatctcttatcttggctgtgtggctcaagtctat
tttttctctgcctttgcatctgctgagctggccttccttactgtcatgtcttatgaccgc
tatgttgccatttgccaccccctccaatacagagccgtgatgacatcaggagggtgctat
cagatggcagtcaccacctggctaagctgcttttcctacgcagccgtccacactggcaac
atgtttcgggagcacgtttgcagatccagtgtgatccaccagttcttccgtgacatccct
catgtgttggccctggtttcctgtgaggttttctttgtagagtttttgaccctggccctg
agctcatgcttggttctgggatgctttattctcatgatgatctcctatttccaaatcttc
tcaacggtgctcagaatcccttcaggacagagtcgagcaaaagccttctccacctgctcc
ccccagctcattgtcatcatgctctttcttaccacagggctctttgctgccttaggacca
attgcaaaagctctgtccattcaggatttagtgattgctctgacatacacagttttgcct
cccttcctcaatcccatcatatatagtcttaggaataaggagattaaaacagccatgtgg
agactctttgtgaagatatattttctgcaaaagtag

DBGET integrated database retrieval system