KEGG   Homo sapiens (human): 402
Entry
402               CDS       T01001                                 

Gene name
ARL2, ARFL2, MRCS1
Definition
(RefSeq) ADP ribosylation factor like GTPase 2
  KO
K07943  ADP-ribosylation factor-like protein 2
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    402 (ARL2)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:hsa04031]
    402 (ARL2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    402 (ARL2)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Arf/Sar Family
   Arl2/Arl3
    402 (ARL2)
SSDB
Motif
Pfam: Arf Roc G-alpha SRPRB Ras Gtr1_RagA MMR_HSR1 TniB GTP_EFTU
Other DBs
NCBI-GeneID: 402
NCBI-ProteinID: NP_001658
OMIM: 601175
HGNC: 693
Ensembl: ENSG00000213465
Vega: OTTHUMG00000165728
Pharos: P36404(Tbio)
UniProt: P36404 Q53YD8
Structure
PDB: 
3DOE 3DOF

Position
11q13.1
AA seq 184 aa
MGLLTILKKMKQKERELRLLMLGLDNAGKTTILKKFNGEDIDTISPTLGFNIKTLEHRGF
KLNIWDVGGQKSLRSYWRNYFESTDGLIWVVDSADRQRMQDCQRELQSLLVEERLAGATL
LIFANKQDLPGALSSNAIREVLELDSIRSHHWCIQGCSAVTGENLLPGIDWLLDDISSRI
FTAD
NT seq 555 nt   +upstreamnt  +downstreamnt
atggggctcctgaccattctgaagaagatgaagcagaaagagcgggagctgcgactgctc
atgcttggcctggacaatgctggaaagacaaccatcctgaagaagttcaatggggaggac
atcgacaccatctccccaacgctgggcttcaacatcaagaccctggagcaccgaggattc
aagctgaacatctgggatgtgggtggccagaagtccctgcggtcctactggcggaactac
tttgagagcaccgatggcctcatctgggtagtggacagcgcagaccgccagcgcatgcag
gactgccagcgggagctccagagcctgctggtggaggagcgcctggccggagcaaccctc
ctcatctttgctaataagcaggacctgcctggagcactgtcctctaacgccatccgcgag
gtcctggagctggactccatccgcagccaccactggtgcatccagggctgcagcgccgtc
accggggagaacctgctgccgggcatcgactggctcctggatgacatttccagccgcatt
ttcacagctgactga

DBGET integrated database retrieval system