KEGG   Homo sapiens (human): 402160
Entry
402160            CDS       T01001                                 

Gene name
CFAP99
Definition
(RefSeq) cilia and flagella associated protein 99
Organism
hsa  Homo sapiens (human)
SSDB
Other DBs
NCBI-GeneID: 402160
NCBI-ProteinID: NP_001180211
HGNC: 51180
Ensembl: ENSG00000206113
Vega: OTTHUMG00000160515
Position
4p16.3
AA seq 646 aa
MAYYGKCIETVIEQLDKFTPKRDNPEQFLEAAATSLQALSPQKQSFVLEVLSGCLEYRKL
LTVVVDAFYVEDGRLCLRVDHSRFEVICYLATFLLEELGFQLFCNIIKSQPVDKMCKFLR
FFFNPLHLCSWIKDEWSLIYEPAHVKENWIDPLMRWQPEVQELINHLEGVSASQSSPLKT
KAKVTEPKEFNLTAPRPRTIPAPEPVPVVAKPRPVPQSTYQPPKEQQQLETVKRYNRRKA
EELLLRANIEELRCAMPRSCRERVQGSKQQLRLQFPPRIRKTPKLTFYRPDNILVKLNTT
AILREGALYQRQVEQELQRVDKLVDGAGDFSEFFEWQKKMQAKDREEQLAASECRRLQGK
LSHEEAVLARQSLMQENKQRVEQQKEQMAKLMLQRAERRLREDRSRKELVEQVIEGQKNA
KAAQTKLAKGRQQTVQEAIEESRGLLQRRAQAAQEEQRRRCELISQLRALETQPTRKGKL
VDLTQIPGYGLEGEMSIVELRERLALLKENQRRKEEEKRDQIIQGKHTKSQELQNMVEQI
SLCRAAMGRSAALRWEEKKALAAAPAAPSQDERVQQLRRRISERAAERSRQAALLHVSAP
RTARPKPRAQLEAQHWLELERSRERRLQALQQGGSGPGPARRLEAA
NT seq 1941 nt   +upstreamnt  +downstreamnt
atggcctactatggaaaatgcattgaaactgtgatcgagcaactcgacaaatttacaccc
aagagggacaaccctgagcagttcctggaggctgcggccacctccctgcaggctctgagc
ccccagaagcagagctttgttttggaggttctgtctgggtgcctcgagtaccggaagctg
ctgaccgtcgtggtggatgccttctacgtggaggatggccgactctgcctgcgggttgac
cacagccgcttcgaggtgatctgctacctagccacattcctgctggaggaactcggcttc
cagctattctgtaacatcatcaagtcccagcccgtggataagatgtgcaagttcctcagg
ttcttcttcaaccccctgcacctgtgctcatggatcaaggatgagtggagcctcatctac
gagccagcccacgtgaaggagaactggatcgaccccctgatgagatggcagccagaggtc
caggagctgatcaaccacctggagggcgtgtctgccagtcaatcctctcctttaaagacc
aaggccaaggtcacagagcccaaggaattcaacctgactgcccccaggccccgcaccatt
ccagcgcccgaaccagtcccggtcgtggccaagccgagacccgtcccccagagcacctac
cagccacccaaggagcagcagcagctggagacagtcaagaggtacaaccgccgaaaggcc
gaggagctgctgctgagggcaaacatcgaggaactgcgctgcgccatgcccaggtcctgc
agggagcgagtgcagggctccaagcagcagctgcggcttcagttcccaccccgaatccga
aagactccgaagctgaccttctataggcctgacaacatcctggtcaagctgaacaccaca
gccatcctgcgagaaggggccttgtaccagcggcaggtggagcaggagctgcagagggtt
gataagctcgtggatggggctggggacttctctgagttcttcgagtggcagaagaagatg
caggcgaaggaccgggaggagcagctggctgcaagcgagtgccggcggttgcaagggaag
cttagccatgaggaggccgtcctagcccggcagagcctcatgcaggagaacaagcagagg
gtggagcagcagaaggagcagatggccaagctgatgctgcagcgtgcagagagacggctc
cgggaggacaggtccaggaaggagctggtggagcaggtgatagaggggcagaagaacgcc
aaggcggcccagacgaagctcgcgaagggccgacagcagacagttcaggaggcgatcgag
gagagcagggggctgctgcagcgcagggcgcaggcagcccaggaggagcagcggcgccgt
tgtgaactcatctcccagctgcgcgcactcgagacacagcccacgcgcaagggcaagctc
gtggacctgacccagatccccggctacggcctggaaggagagatgtccatagtggagctg
cgagagcggctggccctgctcaaagagaatcagcggcgcaaggaggaagaaaagcgggat
caaatcattcagggcaagcacaccaagagccaggaactgcagaacatggtggagcagatc
tcgctgtgccgtgcagccatggggagatccgcagccttgaggtgggaggaaaagaaggcc
cttgcggcggccccggcggcgccctcgcaggacgagcgcgtgcagcagctgcggcgcagg
atctcggagagggcggccgagcgcagcaggcaggcggccttgctgcacgtgtcggcgccg
cggaccgcgcgccccaagccccgggcgcagctagaggcgcagcactggctggagctggag
cggagccgcgagcgcaggctgcaggcgctgcagcagggaggctcaggacccgggcccgcg
cgccgcctggaggccgcctga

DBGET integrated database retrieval system