KEGG   Homo sapiens (human): 4025Help
Entry
4025              CDS       T01001                                 

Gene name
LPO, SPO
Definition
(RefSeq) lactoperoxidase
  KO
K12550  lactoperoxidase [EC:1.11.1.7]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04970 Salivary secretion
    4025 (LPO)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.7  peroxidase
     4025 (LPO)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase
Motif
Other DBs
NCBI-GeneID: 4025
NCBI-ProteinID: NP_006142
OMIM: 150205
HGNC: 6678
Ensembl: ENSG00000167419
Vega: OTTHUMG00000178921
Pharos: P22079(Tbio)
UniProt: P22079
Position
17q22
AA seq 712 aa AA seqDB search
MRVLLHLPALLASLILLQAAASTTRAQTTRTSAISDTVSQAKVQVNKAFLDSRTRLKTAM
SSETPTSRQLSEYLKHAKGRTRTAIRNGQVWEESLKRLRQKASLTNVTDPSLDLTSLSLE
VGCGAPAPVVRCDPCSPYRTITGDCNNRRKPALGAANRALARWLPAEYEDGLSLPFGWTP
GKTRNGFPLPLAREVSNKIVGYLNEEGVLDQNRSLLFMQWGQIVDHDLDFAPDTELGSSE
YSKAQCDEYCIQGDNCFPIMFPPNDPKAGTQGKCMPFFRAGFVCPTPPYKSLAREQINAL
TSFLDASFVYSSEPSLASRLRNLSSPLGLMAVNQEVSDHGLPYLPYDSKKPSPCEFINTT
ARVPCFLAGDSRASEHILLATSHTLFLREHNRLARELKRLNPQWDGEKLYQEARKILGAF
VQIITFRDYLPILLGDHMQKWIPPYQGYSESVDPRISNVFTFAFRFGHLEVPSSMFRLDE
NYQPWGPEPELPLHTLFFNTWRMVKDGGIDPLVRGLLAKKSKLMKQNKMMTGELRNKLFQ
PTHRIHGFDLAAINTQRCRDHGQPGYNSWRAFCDLSQPQTLEELNTVLKSKMLAKKLLGL
YGTPDNIDIWIGAIAEPLVERGRVGPLLACLLGKQFQQIRDGDRFWWENPGVFTNEQKDS
LQKMSFSRLVCDNTRITKVPRDPFWANSYPYDFVDCSAIDKLDLSPWASVKN
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
atgagggtccttctccatctcccagccctcctggcttccctcatcttgcttcaggctgca
gcatctaccacaagagcgcagactaccagaacctctgccatctccgatactgtgagtcag
gccaaggtccaagtcaacaaggccttcctggactcccgaaccaggctgaagaccgccatg
agctctgagactcccaccagccgacagctctcagaatacctcaagcatgccaaaggccgg
acgcgcacagccatccgcaatggacaggtgtgggaggagtctttaaagagactgaggcag
aaggcatccttgaccaatgtcacagatcccagcctggacttgacttcactgtctctggag
gtgggctgtggtgctcctgctcccgtggtgagatgcgacccgtgcagcccttaccgcacc
attacgggagactgcaataacaggaggaagcctgcgctgggcgccgccaacagggctctg
gcgcgctggctgcccgcggagtacgaggacgggctctccctgcccttcggctggacgccg
gggaagacgcgcaacggcttccctctcccgctggcccgggaggtatctaacaagattgtt
ggctatctgaatgaggagggtgttctggaccaaaacaggtccctgctcttcatgcagtgg
ggtcagattgtggatcatgacctggactttgcccctgacaccgagctggggagtagcgag
tactccaaagcccagtgtgatgagtactgtatccagggagacaactgcttccccatcatg
ttcccacccaatgaccccaaggcggggactcaagggaaatgcatgcctttcttccgagct
gggttcgtctgccccactccaccctacaagtccctggcccgagagcagatcaacgctctg
acctccttcctggatgccagctttgtgtacagctccgagccaagcctggccagccgcctc
cgcaacctcagcagccccctgggcctcatggctgtcaaccaggaggtctcagaccatgga
ctaccctacctgccctatgacagcaagaagccaagcccctgtgagttcatcaacaccact
gcccgtgtgccctgcttcctggcaggagattctcgagcctcagagcatattctgctggcc
acatcccacaccctctttctccgcgagcataaccggctggccagagaactaaagagactc
aaccctcagtgggatggagagaagctctaccaggaagcccggaaaatcctgggagccttc
gtgcagattatcacctttagggactacctacccattttgctaggtgaccacatgcagaag
tggatacccccatatcaaggctacagtgaatctgtggatcccagaatttccaatgtcttc
accttcgccttccgctttggccacttggaggtcccctctagtatgttccgcctggatgag
aattatcagccatgggggccagaaccagaactccccctccacaccctcttcttcaacact
tggaggatggtcaaagatggtggaattgatcctctggtgcggggcctgctggccaagaaa
tccaagctgatgaaacagaataaaatgatgactggagagctgcgcaacaagcttttccag
ccaactcacaggatccatggctttgacctggctgccatcaacacacagcgttgccgggac
catgggcaacctgggtacaattcctggagagccttctgtgacctctcacagccgcagaca
ctagaggagttgaacacagtgctgaagagcaagatgctggccaagaagttactgggtctc
tacgggacccctgacaacatcgacatctggataggggccattgctgagccgctggtggaa
aggggtcgggtggggcctctcctggcctgcctcttgggcaagcagttccagcagatccgt
gatggagacaggttctggtgggaaaaccctggggtcttcacgaacgagcagaaggactct
ctacagaaaatgtccttctcacgccttgtctgtgacaacacccgcatcaccaaggtccca
cgggacccattctgggccaacagctacccctatgacttcgtggattgctcagccatcgac
aagctggacctgtcaccctgggcctcagtgaagaattag

DBGET integrated database retrieval system