KEGG   Homo sapiens (human): 402569Help
Entry
402569            CDS       T01001                                 

Gene name
KPNA7, IPOA8
Definition
(RefSeq) karyopherin subunit alpha 7
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Arm HEAT_EZ Arm_3 IBB HEAT_2 HEAT Adaptin_N Cnd1 Arm_2
Motif
Other DBs
NCBI-GeneID: 402569
NCBI-ProteinID: NP_001139187
OMIM: 614107
HGNC: 21839
Ensembl: ENSG00000185467
Vega: OTTHUMG00000154412
Pharos: A9QM74(Tdark)
UniProt: A9QM74
Position
7q22.1
AA seq 516 aa AA seqDB search
MPTLDAPEERRRKFKYRGKDVSLRRQQRMAVSLELRKAKKDEQTLKRRNITSFCPDTPSE
KTAKGVAVSLTLGEIIKGVNSSDPVLCFQATQTARKMLSQEKNPPLKLVIEAGLIPRMVE
FLKSSLYPCLQFEAAWALTNIASGTSEQTRAVVEGGAIQPLIELLSSSNVAVCEQAVWAL
GNIAGDGPEFRDNVITSNAIPHLLALISPTLPITFLRNITWTLSNLCRNKNPYPCDTAVK
QILPALLHLLQHQDSEVLSDACWALSYLTDGSNKRIGQVVNTGVLPRLVVLMTSSELNVL
TPSLRTVGNIVTGTDEQTQMAIDAGMLNVLPQLLQHNKPSIQKEAAWALSNVAAGPCHHI
QQLLAYDVLPPLVALLKNGEFKVQKEAVWMVANFATGATMDQLIQLVHSGVLEPLVNLLT
APDVKIVLIILDVISCILQAAEKRSEKENLCLLIEELGGIDRIEALQLHENRQIGQSALN
IIEKHFGEEEDESQTLLSQVIDQDYEFIDYECLAKK
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgccgaccttagatgctccagaagagaggcggagaaaatttaagtaccgaggcaaagat
gtgtctctgaggcgacagcagaggatggcggtcagtctggagctccgaaaggccaagaaa
gatgaacagaccttaaagagaaggaatatcacgagcttctgccctgacacaccttctgaa
aaaacagccaaaggggtggcggtcagcctcactctgggtgaaataatcaaaggtgtgaat
agctcagatccagtcctatgtttccaggccacccagacagccaggaaaatgctatcccag
gaaaagaacccccctctgaaactggtcattgaagcgggcctcattcccaggatggtggag
ttcctgaagtcatcactttacccctgcttgcagtttgaggctgcctgggccctgaccaac
atcgcttcagggacttcggagcagactcgtgccgtggtagaagggggagccatccagccc
ttgattgagctcctgtcttcctccaacgtggctgtgtgtgaacaggcagtgtgggctctt
ggtaatatagccggtgatggcccagagttcagagataacgtcatcacaagcaatgccatc
ccacatctcctagccttgatttcacccaccctgccgatcacatttctgcggaacatcacg
tggaccttgtcgaatctgtgccgaaacaagaacccatacccttgcgacactgcggtgaag
cagatactgccggccctccttcacctcctgcagcaccaggacagtgaggttctctcggat
gcctgctgggcactgtcctacctcaccgacggctccaacaagcgcatcggccaagtggtt
aacacgggggtcctgcccaggctggtagtgctcatgaccagctcagaactcaatgtcttg
actccttctctccgcaccgtggggaacattgtcacgggcacagatgagcagacgcagatg
gccattgatgcgggtatgctgaacgtgctcccccagctcctgcaacacaacaagccctcc
atccagaaggaggcagcctgggccctgagcaacgtagcagcggggccttgtcaccacatc
cagcagctgcttgcctacgacgtcttgcctcccttggtggctctgctaaaaaacggagaa
tttaaagtccagaaagaggctgtctggatggtggcgaactttgcaacaggggccaccatg
gatcagctgatccagctcgtccactctggggtcctggagccactggtgaatctgctcact
gccccagatgttaaaattgttctcatcatccttgatgtcatctcttgcatcctccaggcg
gcagagaaacggtctgagaaggaaaacctgtgtcttctgatagaagaacttggtgggatc
gatagaattgaggctttacagctgcatgagaaccgtcaaattggccagtcggctttgaac
atcatcgagaagcactttggtgaggaagaagatgagagccaaactttactgagccaagtc
atagaccaagattatgaatttatagattatgaatgcttagcaaaaaaatag

DBGET integrated database retrieval system