KEGG   Homo sapiens (human): 4026Help
Entry
4026              CDS       T01001                                 

Gene name
LPP
Definition
(RefSeq) LIM domain containing preferred translocation partner in lipoma
  KO
K16676  lipoma-prefererred partner
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: LIM
Motif
Other DBs
NCBI-GeneID: 4026
NCBI-ProteinID: NP_001161143
OMIM: 600700
HGNC: 6679
Ensembl: ENSG00000145012
Vega: OTTHUMG00000156387
Pharos: Q93052(Tbio)
UniProt: Q93052 B7ZLW0
Position
3q27.3-q28
AA seq 612 aa AA seqDB search
MSHPSWLPPKSTGEPLGHVPARMETTHSFGNPSISVSTQQPPKKFAPVVAPKPKYNPYKQ
PGGEGDFLPPPPPPLDDSSALPSISGNFPPPPPLDEEAFKVQGNPGGKTLEERRSSLDAE
IDSLTSILADLECSSPYKPRPPQSSTGSTASPPVSTPVTGHKRMVIPNQPPLTATKKSTL
KPQPAPQAGPIPVAPIGTLKPQPQPVPASYTTASTSSRPTFNVQVKSAQPSPHYMAAPSS
GQIYGSGPQGYNTQPVPVSGQCPPPSTRGGMDYAYIPPPGLQPEPGYGYAPNQGRYYEGY
YAAGPGYGGRNDSDPTYGQQGHPNTWKREPGYTPPGAGNQNPPGMYPVTGPKKTYITDPV
SAPCAPPLQPKGGHSGQLGPSSVAPSFRPEDELEHLTKKMLYDMENPPADEYFGRCARCG
ENVVGEGTGCTAMDQVFHVDCFTCIICNNKLRGQPFYAVEKKAYCEPCYINTLEQCNVCS
KPIMERILRATGKAYHPHCFTCVMCHRSLDGIPFTVDAGGLIHCIEDFHKKFAPRCSVCK
EPIMPAPGQEETVRIVALDRDFHVHCYRCEDCGGLLSEGDNQGCYPLDGHILCKTCNSAR
IRVLTAKASTDL
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atgtctcacccatcttggctgccacccaaaagcactggtgagcccctcggccatgtgcct
gcacggatggagaccacccattcctttgggaaccccagcatttcagtgtctacacaacag
ccacccaaaaagtttgccccggtagttgctccaaaacctaagtacaacccatacaaacaa
cctggaggtgagggtgattttcttccacccccacctccacctctagatgattccagtgcc
cttccatctatctctggaaactttcctcctccaccacctcttgatgaagaggctttcaaa
gtacaggggaatcccggaggcaagacacttgaggagaggcgctccagcctggacgctgag
attgactccttgaccagcatcttggctgaccttgagtgcagctccccctataagcctcgg
cctccacagagctccactggttcaacagcctctcctccagtttcgaccccagtcacagga
cacaagagaatggtcatcccgaaccaaccccctctaacagcaaccaagaagtctacattg
aaaccacagcctgcaccccaggctggacccatccctgtggctccaatcggaacactcaaa
ccccagcctcagccagtcccagcctcctacaccacggcctccacttcttcaaggcctacc
tttaatgtgcaggtgaagtcagcccagcccagccctcattatatggctgccccttcatca
ggacaaatttatggctcagggccccagggctataacactcagccagttcctgtctctggg
cagtgtccacctccttcaacacggggaggcatggattatgcctacattccaccaccagga
cttcagccggagcctgggtatgggtatgcccccaaccagggacgctattatgaaggctac
tatgcagcagggccaggctatgggggcagaaatgactctgaccctacctatggtcaacaa
ggtcacccaaatacctggaaacgggaaccagggtacactcctcctggagcagggaaccag
aaccctcctgggatgtatccagtcactggtcccaagaagacctatatcacagatcctgtt
tcagccccctgtgcgccaccattgcagccaaagggtggccattcagggcaactggggcct
tcgtcagttgccccttcattccgcccagaggatgagcttgagcacctgaccaaaaagatg
ctgtatgacatggaaaatccacctgctgacgaatactttggccgctgtgctcgctgtgga
gaaaacgtagttggggaaggtacaggatgcactgccatggatcaggtcttccacgtggat
tgttttacctgcatcatctgcaacaacaagctccgagggcagccattctatgctgtggaa
aagaaagcatactgcgagccctgctacattaatactctggagcagtgcaatgtgtgttcc
aagcccatcatggagcggattctccgagccaccgggaaggcctatcatcctcactgtttc
acctgcgtgatgtgccaccgcagcctggatgggatcccattcactgtggatgctggcggg
ctcattcactgcattgaggacttccacaagaaatttgccccgcgatgttctgtgtgcaag
gagcctattatgccagccccgggccaggaggagactgtccgtattgtggctttggatcga
gatttccatgttcactgctaccgatgcgaggattgcggtggtctcctgtctgaaggagat
aaccaaggctgctaccccttggatgggcacatcctctgcaagacctgcaactctgcccgc
atcagggtgttgaccgccaaggcgagcactgacctttag

DBGET integrated database retrieval system