KEGG   Homo sapiens (human): 402665Help
Entry
402665            CDS       T01001                                 

Gene name
IGLON5
Definition
(RefSeq) IgLON family member 5
  KO
K06773  opioid binding protein/cell adhesion molecule-like
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:hsa04515]
    402665 (IGLON5)
Cell adhesion molecules [BR:hsa04515]
 Immunoglobulin superfamily
  IgLON family
   402665 (IGLON5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_3 I-set ig Ig_2 V-set Ig_6 Izumo-Ig Ig_C17orf99
Motif
Other DBs
NCBI-GeneID: 402665
NCBI-ProteinID: NP_001094842
HGNC: 34550
Ensembl: ENSG00000142549
Vega: OTTHUMG00000154422
Pharos: A6NGN9(Tdark)
UniProt: A6NGN9
Position
19q13.41
AA seq 336 aa AA seqDB search
MPPPAPGARLRLLAAAALAGLAVISRGLLSQSLEFNSPADNYTVCEGDNATLSCFIDEHV
TRVAWLNRSNILYAGNDRWTSDPRVRLLINTPEEFSILITEVGLGDEGLYTCSFQTRHQP
YTTQVYLIVHVPARIVNISSPVTVNEGGNVNLLCLAVGRPEPTVTWRQLRDGFTSEGEIL
EISDIQRGQAGEYECVTHNGVNSAPDSRRVLVTVNYPPTITDVTSARTALGRAALLRCEA
MAVPPADFQWYKDDRLLSSGTAEGLKVQTERTRSMLLFANVSARHYGNYTCRAANRLGAS
SASMRLLRPGSLENSAPRPPGLLALLSALGWLWWRM
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgcccccccctgcgcccggggcccggctccggcttctcgccgccgccgccctggccggc
ttggccgtcatcagccgagggctgctctcccagagcctggagttcaactctcctgccgac
aactacacagtgtgtgaaggtgacaacgccaccctcagctgcttcatcgacgagcacgtg
acccgcgtggcctggctgaaccgctccaacatcctgtatgccggcaatgaccgctggacc
agcgacccgcgggtgcggctgctcatcaacacccccgaggagttctccatcctcatcacc
gaggtggggctcggcgacgagggcctctacacctgctccttccagacccgccaccagccg
tacaccactcaggtctacctcattgtccacgtccctgcccgcattgtgaacatctcgtcg
cctgtgacggtgaatgaggggggcaatgtgaacctgctttgcctggccgtggggcggcca
gagcccacggtcacctggagacagctccgagacggcttcacctcggagggagagatcctg
gagatctctgacatccagcggggccaggccggggagtatgagtgcgtgactcacaacggg
gttaactcggcgcccgacagccgccgcgtgctggtcacagtcaactatcctccgaccatc
acggacgtgaccagcgcccgcaccgcgctgggccgggccgccctcctgcgctgcgaagcc
atggcggttccccccgcggatttccagtggtacaaggatgacagactgctgagcagcggc
acggccgaaggcctgaaggtgcagacggagcgcacccgctcgatgcttctctttgccaac
gtgagcgcccggcattacggcaactatacgtgtcgcgccgccaaccgactgggagcgtcc
agcgcctccatgcggctcctgcgcccaggatccctggagaactcagccccgaggccccca
gggctcctggccctcctctccgccctgggctggctgtggtggagaatgtag

DBGET integrated database retrieval system