KEGG   Homo sapiens (human): 402682Help
Entry
402682            CDS       T01001                                 

Gene name
UFSP1, UFSP
Definition
(RefSeq) UFM1 specific peptidase 1 (inactive)
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C78
Motif
Other DBs
NCBI-GeneID: 402682
NCBI-ProteinID: NP_001015072
OMIM: 611481
HGNC: 33821
Ensembl: ENSG00000176125
Vega: OTTHUMG00000159662
Pharos: Q6NVU6(Tdark)
UniProt: Q6NVU6
Position
7q22.1
AA seq 142 aa AA seqDB search
MGDKPPGFRGSRDWIGCVEASLCLAHFGGPQGRLCHVPRGVGLHGELERLYSHFAGGGGP
VMVGGDADARSKALLGVCVGSGTEAYVLVLDPHYWGTPKSPSELQAAGWVGWQEVSAAFD
PNSFYNLCLTSLSSQQQQRTLD
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atgggcgacaagccccccggcttccggggctcccgggactggatcggctgcgtggaggcc
agcctctgcctcgctcacttcggagggccccagggacgcctctgccacgtaccccgggga
gtggggctgcacggggagctggagaggctttactcgcacttcgcagggggtgggggccca
gtcatggttgggggggacgcagatgccaggtccaaggccttgctgggagtctgcgtaggg
tcaggcacggaagcctatgtcctggtattggaccctcactactggggcactccaaaaagc
cccagtgaactacaggctgctgggtgggtgggctggcaagaggtgagtgcagcctttgac
cccaactccttctacaacctgtgcttgaccagccttagctcccaacagcagcagcgcacc
ttggactga

DBGET integrated database retrieval system