KEGG   Homo sapiens (human): 403Help
Entry
403               CDS       T01001                                 

Gene name
ARL3, ARFL3, JBTS35, RP83
Definition
(RefSeq) ADP ribosylation factor like GTPase 3
  KO
K07944  ADP-ribosylation factor-like protein 3
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    403 (ARL3)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:hsa04031]
    403 (ARL3)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    403 (ARL3)
GTP-binding proteins [BR:hsa04031]
 Small (Monomeric) G-proteins
  Arf/Sar Family
   Arl2/Arl3
    403 (ARL3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arf Roc G-alpha SRPRB Ras Gtr1_RagA MMR_HSR1 GTP_EFTU AAA PduV-EutP AAA_18 AAA_14 FeoB_N CdhD
Motif
Other DBs
NCBI-GeneID: 403
NCBI-ProteinID: NP_004302
OMIM: 604695
HGNC: 694
Ensembl: ENSG00000138175
Vega: OTTHUMG00000018965
Pharos: P36405(Tbio)
UniProt: P36405
Position
10q24.32
AA seq 182 aa AA seqDB search
MGLLSILRKLKSAPDQEVRILLLGLDNAGKTTLLKQLASEDISHITPTQGFNIKSVQSQG
FKLNVWDIGGQRKIRPYWKNYFENTDILIYVIDSADRKRFEETGQELAELLEEEKLSCVP
VLIFANKQDLLTAAPASEIAEGLNLHTIRDRVWQIQSCSALTGEGVQDGMNWVCKNVNAK
KK
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgggcttgctctcaattttgcgcaagttgaaaagtgcaccagaccaggaggtgagaata
cttctcctgggcttggataatgctggcaagaccactcttctgaagcagcttgcatctgaa
gacatcagccacatcacacctacacagggtttcaacatcaaaagtgtacaatcacaaggt
tttaaactgaatgtatgggacattggtggacagaggaaaatcagaccatactggaagaat
tattttgaaaataccgatattcttatatatgtaatcgacagtgcagacagaaaaagattt
gaagagacgggtcaggaactagcggaattactggaggaagaaaaactaagttgtgtgcca
gtgctcatctttgctaataagcaggatttgctcacagcagcccctgcctctgaaattgca
gaaggactgaacctgcataccatccgcgaccgagtctggcagatccagtcttgctcagct
ctcacaggagagggcgttcaggatggcatgaactgggtctgcaaaaatgtcaatgcaaag
aagaaataa

DBGET integrated database retrieval system