KEGG   Homo sapiens (human): 403239Help
Entry
403239            CDS       T01001                                 

Gene name
OR2T27
Definition
(RefSeq) olfactory receptor family 2 subfamily T member 27
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Sensory system
   04740 Olfactory transduction
    403239 (OR2T27)
G protein-coupled receptors [BR:hsa04030]
 Class A. Rhodopsin family
  Chemoreception
   Olfactory
    403239 (OR2T27)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1
Motif
Other DBs
NCBI-GeneID: 403239
NCBI-ProteinID: NP_001001824
HGNC: 31252
Ensembl: ENSG00000187701
Vega: OTTHUMG00000040376
Pharos: Q8NH04(Tdark)
UniProt: Q8NH04
Position
1q44
AA seq 317 aa AA seqDB search
MEQSNYSVYADFILLGLFSNARFPWLLFALILLVFLTSIASNVVKIILIHIDSRLHTPMY
FLLSQLSLRDILYISTIVPKMLVDQVMSQRAISFAGCTAQHFLYLTLAGAEFFLLGLMSY
DRYVAICNPLHYPVLMSRKICWLIVAAAWLGGSIDGFLLTPVTMQFPFCASREINHFFCE
VPALLKLSCTDTSAYETAMYVCCIMMLLIPFSVISGSYTRILITVYRMSEAEGRGKAVAT
CSSHMVVVSLFYGAAMYTYVLPHSYHTPEQDKAVSAFYTILTPMLNPLIYSLRNKDVTGA
LQKVVGRCVSSGKVTTF
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atggagcagagcaattattccgtgtatgccgactttatccttctgggtttgttcagcaac
gcccgtttcccctggcttctctttgccctcattctcctggtctttttgacctccatagcc
agcaacgtggtcaagatcattctcatccacatagactcccgcctccacacccccatgtac
ttcctgctcagccagctctccctcagggacatcctgtatatttccaccattgtgcccaaa
atgctggtcgaccaggtgatgagccagagagccatttcctttgctggatgcactgcccaa
cacttcctctacttgaccttagcaggggctgagttcttcctcctaggactcatgtcctat
gatcgctacgtagccatctgcaaccctctgcactatcctgtcctcatgagccgcaagatc
tgctggttgattgtggcggcagcctggctgggagggtctatcgatggtttcttgctcacc
cccgtcaccatgcagttccccttctgtgcctctcgggagatcaaccacttcttctgcgag
gtgcctgcccttctgaagctctcctgcacggacacatcagcctacgagacagccatgtat
gtctgctgtattatgatgctcctcatccctttctctgtcatctcgggctcttacacaaga
attctcattactgtttataggatgagcgaggcagaggggaggggaaaggctgtggccacc
tgctcctcacacatggtggttgtcagcctcttctatggggctgccatgtacacatacgtg
ctgcctcattcttaccacacccctgagcaggacaaagctgtatctgccttctacaccatc
cttactcccatgctcaatccactcatttacagccttaggaacaaggatgtcacaggggcc
ctacagaaggttgtggggaggtgtgtgtcctcaggaaaggtaaccactttctaa

DBGET integrated database retrieval system