KEGG   Homo sapiens (human): 403278Help
Entry
403278            CDS       T01001                                 

Gene name
OR5K4
Definition
(RefSeq) olfactory receptor family 5 subfamily K member 4
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    403278 (OR5K4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    403278 (OR5K4)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Olfactory
    403278 (OR5K4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 403278
NCBI-ProteinID: NP_001005517
HGNC: 31291
Ensembl: ENSG00000196098
Vega: OTTHUMG00000160081
Pharos: A6NMS3(Tdark)
UniProt: A6NMS3
Position
3q11.2
AA seq 321 aa AA seqDB search
MARENHSLAAEFILIGFTNYPELKTLLFVVFSAIYLVTMVGNLGLVALIYVERRLLTPMY
IFLGNLALMDSCCSCAVTPKMLENFFSEDRIISLYECMAQFYFLCLAETTDCFLLATMAY
DRYVAICHPLQYHTMMSKTLCIRMTTGAFKAGNLHSMIHVGLLLRLTFCRSNKIHHFFCD
ILPLYRLSCTDPSINELMIYIFSIPIQIFTIATVLISYLCILLTVFKMKSKEGRGKAFST
CASHFLSVSIFYICLLMYIGPSEEGDKDTPVAIFYAIVIPLLNPFIYSLRNKEVINVLKK
IMRNYNILKQTCSIANLFLIY
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggctagggaaaatcactccttagcagctgaattcatcctcataggatttacaaattat
ccagagctgaagacgcttctgtttgtggtgttctctgccatctatctggtcaccatggtg
gggaatcttggtctggtggcattaatttatgtagagcgtcgtcttctcacaccaatgtac
atctttctgggcaacctggctctgatggattcctgctgttcctgtgctgttacccccaag
atgttagagaatttcttttctgaggatagaattatttccctgtatgaatgtatggcacaa
ttttattttctctgtcttgctgaaaccacagactgctttcttctggcgacaatggcctat
gaccgctatgtggccatatgccacccactgcagtaccacaccatgatgtccaagacgctc
tgcattcggatgaccacaggggccttcaaagctggaaacctgcattccatgattcatgta
gggcttttattaaggttaactttctgcaggtctaataaaattcaccactttttctgtgat
attcttccactgtatagactctcctgtacagatccttctattaatgaactaatgatatat
atcttttcaataccaattcaaatctttaccattgctactgtcttgatctcttatctctgc
atccttttgactgttttcaaaatgaaatccaaggagggaagaggtaaagcattttctacc
tgtgcatcccactttctctctgtctcaatattttacatttgtcttctcatgtatattgga
ccatctgaagaaggagataaagatacaccagtggcaatattttatgcaatagtaatccca
ttactaaacccttttatttatagtctgagaaataaggaggtcataaatgttcttaaaaaa
attatgaggaattataacattcttaaacaaacttgctctatagcaaatttatttttaatt
tattaa

DBGET integrated database retrieval system