KEGG   Homo sapiens (human): 403314
Entry
403314            CDS       T01001                                 

Symbol
APOBEC4, C1orf169
Name
(RefSeq) apolipoprotein B mRNA editing enzyme catalytic polypeptide like 4
  KO
K18773  C->U-editing enzyme APOBEC4 [EC:3.5.4.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    403314 (APOBEC4)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.-  
     403314 (APOBEC4)
SSDB
Motif
Pfam: APOBEC_N NAD1 APOBEC4 SNAD4 APOBEC2 APOBEC4_like APOBEC1 NAD2 APOBEC3 SCP1201-deam
Other DBs
NCBI-GeneID: 403314
NCBI-ProteinID: NP_982279
OMIM: 609908
HGNC: 32152
Ensembl: ENSG00000173627
Vega: OTTHUMG00000035459
Pharos: Q8WW27(Tdark)
UniProt: Q8WW27
Position
1q25.3
AA seq 367 aa
MEPIYEEYLANHGTIVKPYYWLSFSLDCSNCPYHIRTGEEARVSLTEFCQIFGFPYGTTF
PQTKHLTFYELKTSSGSLVQKGHASSCTGNYIHPESMLFEMNGYLDSAIYNNDSIRHIIL
YSNNSPCNEANHCCISKMYNFLITYPGITLSIYFSQLYHTEMDFPASAWNREALRSLASL
WPRVVLSPISGGIWHSVLHSFISGVSGSHVFQPILTGRALADRHNAYEINAITGVKPYFT
DVLLQTKRNPNTKAQEALESYPLNNAFPGQFFQMPSGQLQPNLPPDLRAPVVFVLVPLRD
LPPMHMGQNPNKPRNIVRHLNMPQMSFQETKDLGRLPTGRSVEIVEITEQFASSKEADEK
KKKKGKK
NT seq 1104 nt   +upstreamnt  +downstreamnt
atggagcccatatatgaggagtacctagcaaatcatggaacaatagtaaaaccatattac
tggctaagcttctctctcgattgctctaattgtccttaccatattcgaacaggtgaagaa
gcaagagtttccctcacagaattttgtcagatttttggattcccttatgggacaacattt
cctcaaacaaaacacctcacattttatgaactaaaaacttcttctggtagcctggtgcaa
aagggccatgctagcagttgcactgggaattatatccatccagaatcaatgctctttgaa
atgaatggttatcttgactcagccatatacaataatgacagcatcaggcatatcattctg
tattccaacaactccccttgtaatgaagctaaccactgctgcatcagcaaaatgtataat
ttcctgattacgtatccaggcatcactcttagtatttatttttctcagctctatcatact
gagatggactttcctgcctcagcatggaaccgcgaagctctccggagcctggccagctta
tggccgcgggttgttttgagtccaataagtggtgggatctggcattctgttctccacagc
tttataagtggtgtctcaggatcacatgtttttcagcccattttaactgggagagcactg
gctgacaggcacaacgcatatgaaatcaatgccataacaggcgtaaaaccttacttcact
gatgttcttctccagacaaaaaggaatccaaacacaaaagctcaggaggctttagagagc
taccccttaaacaatgcctttcctggacagttttttcaaatgccgagtggacaactccaa
cccaacctacctccagacctcagggctcctgttgtttttgtgctagtgcctctcagggac
ttaccaccaatgcatatgggccaaaacccaaataaacccaggaatatcgtaaggcactta
aatatgcctcaaatgtcattccaggaaaccaaggaccttggaaggcttcccactggaagg
tcagtggagatagtggaaatcacagaacagtttgcaagtagcaaggaggcagatgaaaag
aagaagaagaaagggaagaaataa

DBGET integrated database retrieval system