KEGG   Homo sapiens (human): 4035Help
Entry
4035              CDS       T01001                                 

Gene name
LRP1, A2MR, APOER, APR, CD91, IGFBP-3R, IGFBP3R, IGFBP3R1, KPA, LRP, LRP1A, TGFBR5
Definition
(RefSeq) LDL receptor related protein 1
  KO
K04550  low-density lipoprotein receptor-related protein 1 (alpha-2-macroglobulin receptor)
Organism
hsa  Homo sapiens (human)
Pathway
hsa04979  Cholesterol metabolism
hsa05010  Alzheimer disease
hsa05144  Malaria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04979 Cholesterol metabolism
    4035 (LRP1)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    4035 (LRP1)
  09167 Infectious diseases
   05144 Malaria
    4035 (LRP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    4035 (LRP1)
  09183 Protein families: signaling and cellular processes
   04090 CD Molecules [BR:hsa04090]
    4035 (LRP1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    4035 (LRP1)
CD molecules [BR:hsa04090]
 Proteins
  4035 (LRP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ldl_recept_a Ldl_recept_b FXa_inhibition DUF5050 SGL cEGF EGF_CA EGF TadE
Motif
Other DBs
NCBI-GeneID: 4035
NCBI-ProteinID: NP_002323
OMIM: 107770
HGNC: 6692
Ensembl: ENSG00000123384
Vega: OTTHUMG00000044412
Pharos: Q07954(Tbio)
UniProt: Q07954 Q59FG2
Structure
PDB: 

Position
12q13.3
AA seq 4544 aa AA seqDB search
MLTPPLLLLLPLLSALVAAAIDAPKTCSPKQFACRDQITCISKGWRCDGERDCPDGSDEA
PEICPQSKAQRCQPNEHNCLGTELCVPMSRLCNGVQDCMDGSDEGPHCRELQGNCSRLGC
QHHCVPTLDGPTCYCNSSFQLQADGKTCKDFDECSVYGTCSQLCTNTDGSFICGCVEGYL
LQPDNRSCKAKNEPVDRPPVLLIANSQNILATYLSGAQVSTITPTSTRQTTAMDFSYANE
TVCWVHVGDSAAQTQLKCARMPGLKGFVDEHTINISLSLHHVEQMAIDWLTGNFYFVDDI
DDRIFVCNRNGDTCVTLLDLELYNPKGIALDPAMGKVFFTDYGQIPKVERCDMDGQNRTK
LVDSKIVFPHGITLDLVSRLVYWADAYLDYIEVVDYEGKGRQTIIQGILIEHLYGLTVFE
NYLYATNSDNANAQQKTSVIRVNRFNSTEYQVVTRVDKGGALHIYHQRRQPRVRSHACEN
DQYGKPGGCSDICLLANSHKARTCRCRSGFSLGSDGKSCKKPEHELFLVYGKGRPGIIRG
MDMGAKVPDEHMIPIENLMNPRALDFHAETGFIYFADTTSYLIGRQKIDGTERETILKDG
IHNVEGVAVDWMGDNLYWTDDGPKKTISVARLEKAAQTRKTLIEGKMTHPRAIVVDPLNG
WMYWTDWEEDPKDSRRGRLERAWMDGSHRDIFVTSKTVLWPNGLSLDIPAGRLYWVDAFY
DRIETILLNGTDRKIVYEGPELNHAFGLCHHGNYLFWTEYRSGSVYRLERGVGGAPPTVT
LLRSERPPIFEIRMYDAQQQQVGTNKCRVNNGGCSSLCLATPGSRQCACAEDQVLDADGV
TCLANPSYVPPPQCQPGEFACANSRCIQERWKCDGDNDCLDNSDEAPALCHQHTCPSDRF
KCENNRCIPNRWLCDGDNDCGNSEDESNATCSARTCPPNQFSCASGRCIPISWTCDLDDD
CGDRSDESASCAYPTCFPLTQFTCNNGRCININWRCDNDNDCGDNSDEAGCSHSCSSTQF
KCNSGRCIPEHWTCDGDNDCGDYSDETHANCTNQATRPPGGCHTDEFQCRLDGLCIPLRW
RCDGDTDCMDSSDEKSCEGVTHVCDPSVKFGCKDSARCISKAWVCDGDNDCEDNSDEENC
ESLACRPPSHPCANNTSVCLPPDKLCDGNDDCGDGSDEGELCDQCSLNNGGCSHNCSVAP
GEGIVCSCPLGMELGPDNHTCQIQSYCAKHLKCSQKCDQNKFSVKCSCYEGWVLEPDGES
CRSLDPFKPFIIFSNRHEIRRIDLHKGDYSVLVPGLRNTIALDFHLSQSALYWTDVVEDK
IYRGKLLDNGALTSFEVVIQYGLATPEGLAVDWIAGNIYWVESNLDQIEVAKLDGTLRTT
LLAGDIEHPRAIALDPRDGILFWTDWDASLPRIEAASMSGAGRRTVHRETGSGGWPNGLT
VDYLEKRILWIDARSDAIYSARYDGSGHMEVLRGHEFLSHPFAVTLYGGEVYWTDWRTNT
LAKANKWTGHNVTVVQRTNTQPFDLQVYHPSRQPMAPNPCEANGGQGPCSHLCLINYNRT
VSCACPHLMKLHKDNTTCYEFKKFLLYARQMEIRGVDLDAPYYNYIISFTVPDIDNVTVL
DYDAREQRVYWSDVRTQAIKRAFINGTGVETVVSADLPNAHGLAVDWVSRNLFWTSYDTN
KKQINVARLDGSFKNAVVQGLEQPHGLVVHPLRGKLYWTDGDNISMANMDGSNRTLLFSG
QKGPVGLAIDFPESKLYWISSGNHTINRCNLDGSGLEVIDAMRSQLGKATALAIMGDKLW
WADQVSEKMGTCSKADGSGSVVLRNSTTLVMHMKVYDESIQLDHKGTNPCSVNNGDCSQL
CLPTSETTRSCMCTAGYSLRSGQQACEGVGSFLLYSVHEGIRGIPLDPNDKSDALVPVSG
TSLAVGIDFHAENDTIYWVDMGLSTISRAKRDQTWREDVVTNGIGRVEGIAVDWIAGNIY
WTDQGFDVIEVARLNGSFRYVVISQGLDKPRAITVHPEKGYLFWTEWGQYPRIERSRLDG
TERVVLVNVSISWPNGISVDYQDGKLYWCDARTDKIERIDLETGENREVVLSSNNMDMFS
VSVFEDFIYWSDRTHANGSIKRGSKDNATDSVPLRTGIGVQLKDIKVFNRDRQKGTNVCA
VANGGCQQLCLYRGRGQRACACAHGMLAEDGASCREYAGYLLYSERTILKSIHLSDERNL
NAPVQPFEDPEHMKNVIALAFDYRAGTSPGTPNRIFFSDIHFGNIQQINDDGSRRITIVE
NVGSVEGLAYHRGWDTLYWTSYTTSTITRHTVDQTRPGAFERETVITMSGDDHPRAFVLD
ECQNLMFWTNWNEQHPSIMRAALSGANVLTLIEKDIRTPNGLAIDHRAEKLYFSDATLDK
IERCEYDGSHRYVILKSEPVHPFGLAVYGEHIFWTDWVRRAVQRANKHVGSNMKLLRVDI
PQQPMGIIAVANDTNSCELSPCRINNGGCQDLCLLTHQGHVNCSCRGGRILQDDLTCRAV
NSSCRAQDEFECANGECINFSLTCDGVPHCKDKSDEKPSYCNSRRCKKTFRQCSNGRCVS
NMLWCNGADDCGDGSDEIPCNKTACGVGEFRCRDGTCIGNSSRCNQFVDCEDASDEMNCS
ATDCSSYFRLGVKGVLFQPCERTSLCYAPSWVCDGANDCGDYSDERDCPGVKRPRCPLNY
FACPSGRCIPMSWTCDKEDDCEHGEDETHCNKFCSEAQFECQNHRCISKQWLCDGSDDCG
DGSDEAAHCEGKTCGPSSFSCPGTHVCVPERWLCDGDKDCADGADESIAAGCLYNSTCDD
REFMCQNRQCIPKHFVCDHDRDCADGSDESPECEYPTCGPSEFRCANGRCLSSRQWECDG
ENDCHDQSDEAPKNPHCTSQEHKCNASSQFLCSSGRCVAEALLCNGQDDCGDSSDERGCH
INECLSRKLSGCSQDCEDLKIGFKCRCRPGFRLKDDGRTCADVDECSTTFPCSQRCINTH
GSYKCLCVEGYAPRGGDPHSCKAVTDEEPFLIFANRYYLRKLNLDGSNYTLLKQGLNNAV
ALDFDYREQMIYWTDVTTQGSMIRRMHLNGSNVQVLHRTGLSNPDGLAVDWVGGNLYWCD
KGRDTIEVSKLNGAYRTVLVSSGLREPRALVVDVQNGYLYWTDWGDHSLIGRIGMDGSSR
SVIVDTKITWPNGLTLDYVTERIYWADAREDYIEFASLDGSNRHVVLSQDIPHIFALTLF
EDYVYWTDWETKSINRAHKTTGTNKTLLISTLHRPMDLHVFHALRQPDVPNHPCKVNNGG
CSNLCLLSPGGGHKCACPTNFYLGSDGRTCVSNCTASQFVCKNDKCIPFWWKCDTEDDCG
DHSDEPPDCPEFKCRPGQFQCSTGICTNPAFICDGDNDCQDNSDEANCDIHVCLPSQFKC
TNTNRCIPGIFRCNGQDNCGDGEDERDCPEVTCAPNQFQCSITKRCIPRVWVCDRDNDCV
DGSDEPANCTQMTCGVDEFRCKDSGRCIPARWKCDGEDDCGDGSDEPKEECDERTCEPYQ
FRCKNNRCVPGRWQCDYDNDCGDNSDEESCTPRPCSESEFSCANGRCIAGRWKCDGDHDC
ADGSDEKDCTPRCDMDQFQCKSGHCIPLRWRCDADADCMDGSDEEACGTGVRTCPLDEFQ
CNNTLCKPLAWKCDGEDDCGDNSDENPEECARFVCPPNRPFRCKNDRVCLWIGRQCDGTD
NCGDGTDEEDCEPPTAHTTHCKDKKEFLCRNQRCLSSSLRCNMFDDCGDGSDEEDCSIDP
KLTSCATNASICGDEARCVRTEKAAYCACRSGFHTVPGQPGCQDINECLRFGTCSQLCNN
TKGGHLCSCARNFMKTHNTCKAEGSEYQVLYIADDNEIRSLFPGHPHSAYEQAFQGDESV
RIDAMDVHVKAGRVYWTNWHTGTISYRSLPPAAPPTTSNRHRRQIDRGVTHLNISGLKMP
RGIAIDWVAGNVYWTDSGRDVIEVAQMKGENRKTLISGMIDEPHAIVVDPLRGTMYWSDW
GNHPKIETAAMDGTLRETLVQDNIQWPTGLAVDYHNERLYWADAKLSVIGSIRLNGTDPI
VAADSKRGLSHPFSIDVFEDYIYGVTYINNRVFKIHKFGHSPLVNLTGGLSHASDVVLYH
QHKQPEVTNPCDRKKCEWLCLLSPSGPVCTCPNGKRLDNGTCVPVPSPTPPPDAPRPGTC
NLQCFNGGSCFLNARRQPKCRCQPRYTGDKCELDQCWEHCRNGGTCAASPSGMPTCRCPT
GFTGPKCTQQVCAGYCANNSTCTVNQGNQPQCRCLPGFLGDRCQYRQCSGYCENFGTCQM
AADGSRQCRCTAYFEGSRCEVNKCSRCLEGACVVNKQSGDVTCNCTDGRVAPSCLTCVGH
CSNGGSCTMNSKMMPECQCPPHMTGPRCEEHVFSQQQPGHIASILIPLLLLLLLVLVAGV
VFWYKRRVQGAKGFQHQRMTNGAMNVEIGNPTYKMYEGGEPDDVGGLLDADFALDPDKPT
NFTNPVYATLYMGGHGSRHSLASTDEKRELLGRGPEDEIGDPLA
NT seq 13635 nt NT seq  +upstreamnt  +downstreamnt
atgctgaccccgccgttgctcctgctgctgcccctgctctcagctctggtcgcggcggct
atcgacgcccctaagacttgcagccccaagcagtttgcctgcagagatcaaataacctgt
atctcaaagggctggcggtgcgacggtgagagggactgcccagacggatctgacgaggcc
cctgagatttgtccacagagtaaggcccagcgatgccagccaaacgagcataactgcctg
ggtactgagctgtgtgttcccatgtcccgcctctgcaatggggtccaggactgcatggac
ggctcagatgaggggccccactgccgagagctccaaggcaactgctctcgcctgggctgc
cagcaccattgtgtccccacactcgatgggcccacctgctactgcaacagcagctttcag
cttcaggcagatggcaagacctgcaaagattttgatgagtgctcagtgtacggcacctgc
agccagctatgcaccaacacagacggctccttcatatgtggctgtgttgaaggatacctc
ctgcagccggataaccgctcctgcaaggccaagaacgagccagtagaccggccccctgtg
ctgttgatagccaactcccagaacatcttggccacgtacctgagtggggcccaggtgtct
accatcacacctacgagcacgcggcagaccacagccatggacttcagctatgccaacgag
accgtatgctgggtgcatgttggggacagtgctgctcagacgcagctcaagtgtgcccgc
atgcctggcctaaagggcttcgtggatgagcacaccatcaacatctccctcagtctgcac
cacgtggaacagatggccatcgactggctgacaggcaacttctactttgtggatgacatc
gatgataggatctttgtctgcaacagaaatggggacacatgtgtcacattgctagacctg
gaactctacaaccccaagggcattgccctggaccctgccatggggaaggtgtttttcact
gactatgggcagatcccaaaggtggaacgctgtgacatggatgggcagaaccgcaccaag
ctcgtcgacagcaagattgtgtttcctcatggcatcacgctggacctggtcagccgcctt
gtctactgggcagatgcctatctggactatattgaagtggtggactatgagggcaagggc
cgccagaccatcatccagggcatcctgattgagcacctgtacggcctgactgtgtttgag
aattatctctatgccaccaactcggacaatgccaatgcccagcagaagacgagtgtgatc
cgtgtgaaccgctttaacagcaccgagtaccaggttgtcacccgggtggacaagggtggt
gccctccacatctaccaccagaggcgtcagccccgagtgaggagccatgcctgtgaaaac
gaccagtatgggaagccgggtggctgctctgacatctgcctgctggccaacagccacaag
gcgcggacctgccgctgccgttccggcttcagcctgggcagtgacgggaagtcatgcaag
aagccggagcatgagctgttcctcgtgtatggcaagggccggccaggcatcatccggggc
atggatatgggggccaaggtcccggatgagcacatgatccccattgaaaacctcatgaac
ccccgagccctggacttccacgctgagaccggcttcatctactttgccgacaccaccagc
tacctcattggccgccagaagattgatggcactgagcgggagaccatcctgaaggacggc
atccacaatgtggagggtgtggccgtggactggatgggagacaatctgtactggacggac
gatgggcccaaaaagacaatcagcgtggccaggctggagaaagctgctcagacccgcaag
actttaatcgagggcaaaatgacacaccccagggctattgtggtggatccactcaatggg
tggatgtactggacagactgggaggaggaccccaaggacagtcggcgtgggcggctggag
agggcgtggatggatggctcacaccgagacatctttgtcacctccaagacagtgctttgg
cccaatgggctaagcctggacatcccggctgggcgcctctactgggtggatgccttctac
gaccgcatcgagacgatactgctcaatggcacagaccggaagattgtgtatgaaggtcct
gagctgaaccacgcctttggcctgtgtcaccatggcaactacctcttctggactgagtat
cggagtggcagtgtctaccgcttggaacggggtgtaggaggcgcaccccccactgtgacc
cttctgcgcagtgagcggccccccatctttgagatccgaatgtatgatgcccagcagcag
caagttggcaccaacaaatgccgggtgaacaatggcggctgcagcagcctgtgcttggcc
acccctgggagccgccagtgcgcctgtgctgaggaccaggtgttggacgcagacggcgtc
acttgcttggcgaacccatcctacgtgcctccaccccagtgccagccaggcgagtttgcc
tgtgccaacagccgctgcatccaggagcgctggaagtgtgacggagacaacgattgcctg
gacaacagtgatgaggccccagccctctgccatcagcacacctgcccctcggaccgattc
aagtgcgagaacaaccggtgcatccccaaccgctggctctgcgacggggacaatgactgt
gggaacagtgaagatgagtccaatgccacttgttcagcccgcacctgcccccccaaccag
ttctcctgtgccagtggccgctgcatccccatctcctggacgtgtgatctggatgacgac
tgtggggaccgctctgatgagtctgcttcgtgtgcctatcccacctgcttccccctgact
cagtttacctgcaacaatggcagatgtatcaacatcaactggagatgcgacaatgacaat
gactgtggggacaacagtgacgaagccggctgcagccactcctgttctagcacccagttc
aagtgcaacagcgggcgttgcatccccgagcactggacctgcgatggggacaatgactgc
ggagactacagtgatgagacacacgccaactgcaccaaccaggccacgaggccccctggt
ggctgccacactgatgagttccagtgccggctggatggactatgcatccccctgcggtgg
cgctgcgatggggacactgactgcatggactccagcgatgagaagagctgtgagggagtg
acccacgtctgcgatcccagtgtcaagtttggctgcaaggactcagctcggtgcatcagc
aaagcgtgggtgtgtgatggcgacaatgactgtgaggataactcggacgaggagaactgc
gagtccctggcctgcaggccaccctcgcacccttgtgccaacaacacctcagtctgcctg
ccccctgacaagctgtgtgatggcaacgacgactgtggcgacggctcagatgagggcgag
ctctgcgaccagtgctctctgaataacggtggctgcagccacaactgctcagtggcacct
ggcgaaggcattgtgtgttcctgccctctgggcatggagctggggcccgacaaccacacc
tgccagatccagagctactgtgccaagcatctcaaatgcagccaaaagtgcgaccagaac
aagttcagcgtgaagtgctcctgctacgagggctgggtcctggaacctgacggcgagagc
tgccgcagcctggaccccttcaagccgttcatcattttctccaaccgccatgaaatccgg
cgcatcgatcttcacaaaggagactacagcgtcctggtgcccggcctgcgcaacaccatc
gccctggacttccacctcagccagagcgccctctactggaccgacgtggtggaggacaag
atctaccgcgggaagctgctggacaacggagccctgactagtttcgaggtggtgattcag
tatggcctggccacacccgagggcctggctgtagactggattgcaggcaacatctactgg
gtggagagtaacctggatcagatcgaggtggccaagctggatgggaccctccggaccacc
ctgctggccggtgacattgagcacccaagggcaatcgcactggatccccgggatgggatc
ctgttttggacagactgggatgccagcctgccccgcattgaggcagcctccatgagtggg
gctgggcgccgcaccgtgcaccgggagaccggctctgggggctggcccaacgggctcacc
gtggactacctggagaagcgcatcctttggattgacgccaggtcagatgccatttactca
gcccgttacgacggctctggccacatggaggtgcttcggggacacgagttcctgtcgcac
ccgtttgcagtgacgctgtacgggggggaggtctactggactgactggcgaacaaacaca
ctggctaaggccaacaagtggaccggccacaatgtcaccgtggtacagaggaccaacacc
cagccctttgacctgcaggtgtaccacccctcccgccagcccatggctcccaatccctgt
gaggccaatgggggccagggcccctgctcccacctgtgtctcatcaactacaaccggacc
gtgtcctgcgcctgcccccacctcatgaagctccacaaggacaacaccacctgctatgag
tttaagaagttcctgctgtacgcacgtcagatggagatccgaggtgtggacctggatgct
ccctactacaactacatcatctccttcacggtgcccgacatcgacaacgtcacagtgcta
gactacgatgcccgcgagcagcgtgtgtactggtctgacgtgcggacacaggccatcaag
cgggccttcatcaacggcacaggcgtggagacagtcgtctctgcagacttgccaaatgcc
cacgggctggctgtggactgggtctcccgaaacctgttctggacaagctatgacaccaat
aagaagcagatcaatgtggcccggctggatggctccttcaagaacgcagtggtgcagggc
ctggagcagccccatggccttgtcgtccaccctctgcgtgggaagctctactggaccgat
ggtgacaacatcagcatggccaacatggatggcagcaatcgcaccctgctcttcagtggc
cagaagggccccgtgggcctggctattgacttccctgaaagcaaactctactggatcagc
tccgggaaccataccatcaaccgctgcaacctggatgggagtgggctggaggtcatcgat
gccatgcggagccagctgggcaaggccaccgccctggccatcatgggggacaagctgtgg
tgggctgatcaggtgtcggaaaagatgggcacatgcagcaaggctgacggctcgggctcc
gtggtccttcggaacagcaccaccctggtgatgcacatgaaggtctatgacgagagcatc
cagctggaccataagggcaccaacccctgcagtgtcaacaacggtgactgctcccagctc
tgcctgcccacgtcagagacgacccgctcctgcatgtgcacagccggctatagcctccgg
agtggccagcaggcctgcgagggcgtaggttcctttctcctgtactctgtgcatgaggga
atcaggggaattcccctggatcccaatgacaagtcagatgccctggtcccagtgtccggg
acctcgctggctgtcggcatcgacttccacgctgaaaatgacaccatctactgggtggac
atgggcctgagcacgatcagccgggccaagcgggaccagacgtggcgtgaagacgtggtg
accaatggcattggccgtgtggagggcattgcagtggactggatcgcaggcaacatctac
tggacagaccagggctttgatgtcatcgaggtcgcccggctcaatggctccttccgctac
gtggtgatctcccagggtctagacaagccccgggccatcaccgtccacccggagaaaggg
tacttgttctggactgagtggggtcagtatccgcgtattgagcggtctcggctagatggc
acggagcgtgtggtgctggtcaacgtcagcatcagctggcccaacggcatctcagtggac
taccaggatgggaagctgtactggtgcgatgcacggacagacaagattgaacggatcgac
ctggagacaggtgagaaccgcgaggtggttctgtccagcaacaacatggacatgttttca
gtgtctgtgtttgaggatttcatctactggagtgacaggactcatgccaacggctctatc
aagcgcgggagcaaagacaatgccacagactccgtgcccctgcgaaccggcatcggcgtc
cagcttaaagacatcaaagtcttcaaccgggaccggcagaaaggcaccaacgtgtgcgcg
gtggccaatggcgggtgccagcagctgtgcctgtaccggggccgtgggcagcgggcctgc
gcctgtgcccacgggatgctggctgaagacggagcatcgtgccgcgagtatgccggctac
ctgctctactcagagcgcaccattctcaagagtatccacctgtcggatgagcgcaacctc
aatgcgcccgtgcagcccttcgaggaccctgagcacatgaagaacgtcatcgccctggcc
tttgactaccgggcaggcacctctccgggcacccccaatcgcatcttcttcagcgacatc
cactttgggaacatccaacagatcaacgacgatggctccaggaggatcaccattgtggaa
aacgtgggctccgtggaaggcctggcctatcaccgtggctgggacactctctattggaca
agctacacgacatccaccatcacgcgccacacagtggaccagacccgcccaggggccttc
gagcgtgagaccgtcatcactatgtctggagatgaccacccacgggccttcgttttggac
gagtgccagaacctcatgttctggaccaactggaatgagcagcatcccagcatcatgcgg
gcggcgctctcgggagccaatgtcctgacccttatcgagaaggacatccgtacccccaat
ggcctggccatcgaccaccgtgccgagaagctctacttctctgacgccaccctggacaag
atcgagcggtgcgagtatgacggctcccaccgctatgtgatcctaaagtcagagcctgtc
caccccttcgggctggccgtgtatggggagcacattttctggactgactgggtgcggcgg
gcagtgcagcgggccaacaagcacgtgggcagcaacatgaagctgctgcgcgtggacatc
ccccagcagcccatgggcatcatcgccgtggccaacgacaccaacagctgtgaactctct
ccatgccgaatcaacaacggtggctgccaggacctgtgtctgctcactcaccagggccat
gtcaactgctcatgccgagggggccgaatcctccaggatgacctcacctgccgagcggtg
aattcctcttgccgagcacaagatgagtttgagtgtgccaatggcgagtgcatcaacttc
agcctgacctgcgacggcgtcccccactgcaaggacaagtccgatgagaagccatcctac
tgcaactcccgccgctgcaagaagactttccggcagtgcagcaatgggcgctgtgtgtcc
aacatgctgtggtgcaacggggccgacgactgtggggatggctctgacgagatcccttgc
aacaagacagcctgtggtgtgggcgagttccgctgccgggacgggacctgcatcgggaac
tccagccgctgcaaccagtttgtggattgtgaggacgcctcagatgagatgaactgcagt
gccaccgactgcagcagctacttccgcctgggcgtgaagggcgtgctcttccagccctgc
gagcggacctcactctgctacgcacccagctgggtgtgtgatggcgccaatgactgtggg
gactacagtgatgagcgcgactgcccaggtgtgaaacgccccagatgccctctgaattac
ttcgcctgccctagtgggcgctgcatccccatgagctggacgtgtgacaaagaggatgac
tgtgaacatggcgaggacgagacccactgcaacaagttctgctcagaggcccagtttgag
tgccagaaccatcgctgcatctccaagcagtggctgtgtgacggcagcgatgactgtggg
gatggctcagacgaggctgctcactgtgaaggcaagacgtgcggcccctcctccttctcc
tgccctggcacccacgtgtgcgtccccgagcgctggctctgtgacggtgacaaagactgt
gctgatggtgcagacgagagcatcgcagctggttgcttgtacaacagcacttgtgacgac
cgtgagttcatgtgccagaaccgccagtgcatccccaagcacttcgtgtgtgaccacgac
cgtgactgtgcagatggctctgatgagtcccccgagtgtgagtacccgacctgcggcccc
agtgagttccgctgtgccaatgggcgctgtctgagctcccgccagtgggagtgtgatggc
gagaatgactgccacgaccagagtgacgaggctcccaagaacccacactgcaccagccaa
gagcacaagtgcaatgcctcgtcacagttcctgtgcagcagtgggcgctgtgtggctgag
gcactgctctgcaacggccaggatgactgtggcgacagctcggacgagcgtggctgccac
atcaatgagtgtctcagccgcaagctcagtggctgcagccaggactgtgaggacctcaag
atcggcttcaagtgccgctgtcgccctggcttccggctgaaggacgacggccggacgtgt
gctgatgtggacgagtgcagcaccaccttcccctgcagccagcgctgcatcaacactcat
ggcagctataagtgtctgtgtgtggagggctatgcaccccgcggcggcgacccccacagc
tgcaaggctgtgactgacgaggaaccgtttctgatcttcgccaaccggtactacctgcgc
aagctcaacctggacgggtccaactacacgttacttaagcagggcctgaacaacgccgtt
gccttggattttgactaccgagagcagatgatctactggacagatgtgaccacccagggc
agcatgatccgaaggatgcaccttaacgggagcaatgtgcaggtcctacaccgtacaggc
ctcagcaaccccgatgggctggctgtggactgggtgggtggcaacctgtactggtgcgac
aaaggccgggacaccatcgaggtgtccaagctcaatggggcctatcggacggtgctggtc
agctctggcctccgtgagcccagggctctggtggtggatgtgcagaatgggtacctgtac
tggacagactggggtgaccattcactgatcggccgcatcggcatggatgggtccagccgc
agcgtcatcgtggacaccaagatcacatggcccaatggcctgacgctggactatgtcact
gagcgcatctactgggccgacgcccgcgaggactacattgaatttgccagcctggatggc
tccaatcgccacgttgtgctgagccaggacatcccgcacatctttgcactgaccctgttt
gaggactacgtctactggaccgactgggaaacaaagtccattaaccgagcccacaagacc
acgggcaccaacaaaacgctcctcatcagcacgctgcaccggcccatggacctgcatgtc
ttccatgccctgcgccagccagacgtgcccaatcacccctgcaaggtcaacaatggtggc
tgcagcaacctgtgcctgctgtcccccgggggagggcacaaatgtgcctgccccaccaac
ttctacctgggcagcgatgggcgcacctgtgtgtccaactgcacggctagccagtttgta
tgcaagaacgacaagtgcatccccttctggtggaagtgtgacaccgaggacgactgcggg
gaccactcagacgagcccccggactgccctgagttcaagtgccggcccggacagttccag
tgctccacaggtatctgcacaaaccctgccttcatctgcgatggcgacaatgactgccag
gacaacagtgacgaggccaactgtgacatccacgtctgcttgcccagtcagttcaaatgc
accaacaccaaccgctgtattcccggcatcttccgctgcaatgggcaggacaactgcgga
gatggggaggatgagagggactgccccgaggtgacctgcgcccccaaccagttccagtgc
tccattaccaaacggtgcatcccccgggtctgggtctgcgaccgggacaatgactgtgtg
gatggcagtgatgagcccgccaactgcacccagatgacctgtggtgtggacgagttccgc
tgcaaggattcgggccgctgcatcccagcgcgttggaagtgtgacggagaggatgactgt
ggggatggctcggatgagcccaaggaagagtgtgatgaacgcacctgtgagccataccag
ttccgctgcaagaacaaccgctgcgtgcccggccgctggcagtgcgactacgacaacgat
tgcggtgacaactccgatgaagagagctgcacccctcggccctgctccgagagtgagttc
tcctgtgccaacggccgctgcatcgcggggcgctggaaatgcgatggagaccacgactgc
gcggacggctcggacgagaaagactgcaccccccgctgtgacatggaccagttccagtgc
aagagcggccactgcatccccctgcgctggcgctgtgacgcagacgccgactgcatggac
ggcagcgacgaggaggcctgcggcactggcgtgcggacctgccccctggacgagttccag
tgcaacaacaccttgtgcaagccgctggcctggaagtgcgatggcgaggatgactgtggg
gacaactcagatgagaaccccgaggagtgtgcccggttcgtgtgccctcccaaccggccc
ttccgttgcaagaatgaccgcgtctgtctgtggatcgggcgccaatgcgatggcacggac
aactgtggggatgggactgatgaagaggactgtgagccccccacagcccacaccacccac
tgcaaagacaagaaggagtttctgtgccggaaccagcgctgcctctcctcctccctgcgc
tgcaacatgttcgatgactgcggggacggctctgacgaggaggactgcagcatcgacccc
aagctgaccagctgcgccaccaatgccagcatctgtggggacgaggcacgctgcgtgcgc
accgagaaagcggcctactgtgcctgccgctcgggcttccacaccgtgcccggccagccc
ggatgccaagacatcaacgagtgcctgcgcttcggcacctgctcccagctctgcaacaac
accaagggcggccacctctgcagctgcgctcggaacttcatgaagacgcacaacacctgc
aaggccgaaggctctgagtaccaggtcctgtacatcgctgatgacaatgagatccgcagc
ctgttccccggccacccccattcggcttacgagcaggcattccagggtgacgagagtgtc
cgcattgatgctatggatgtccatgtcaaggctggccgtgtctattggaccaactggcac
acgggcaccatctcctaccgcagcctgccacctgctgcgcctcctaccacttccaaccgc
caccggcgacagattgaccggggtgtcacccacctcaacatttcagggctgaagatgccc
agaggcatcgccatcgactgggtggccggaaacgtgtactggaccgactcgggccgagat
gtgattgaggtggcgcagatgaagggcgagaaccgcaagacgctcatctcgggcatgatt
gacgagccccacgccattgtggtggacccactgagggggaccatgtactggtcagactgg
ggcaaccaccccaagattgagacggcagcgatggatgggacgcttcgggagacactggtg
caggacaacattcagtggcccacaggcctggccgtggattatcacaatgagcggctgtac
tgggcagacgccaagctttcagtcatcggcagcatccggctcaatggcacggaccccatt
gtggctgctgacagcaaacgaggcctaagtcaccccttcagcatcgacgtctttgaggat
tacatctatggtgtcacctacatcaataatcgtgtcttcaagatccataagtttggccac
agccccttggtcaacctgacagggggcctgagccacgcctctgacgtggtcctttaccat
cagcacaagcagcccgaagtgaccaacccatgtgaccgcaagaaatgcgagtggctctgc
ctgctgagccccagtgggcctgtctgcacctgtcccaatgggaagcggctggacaacggc
acatgcgtgcctgtgccctctccaacgccccccccagatgctccccggcctggaacctgt
aacctgcagtgcttcaacggtggcagctgtttcctcaatgcacggaggcagcccaagtgc
cgctgccaaccccgctacacgggtgacaagtgtgaactggaccagtgctgggagcactgt
cgcaatgggggcacctgtgctgcctccccctctggcatgcccacgtgccggtgccccacg
ggcttcacgggccccaaatgcacccagcaggtgtgtgcgggctactgtgccaacaacagc
acctgcactgtcaaccagggcaaccagccccagtgccgatgcctacccggcttcctgggc
gaccgctgccagtaccggcagtgctctggctactgtgagaactttggcacatgccagatg
gctgctgatggctcccgacaatgccgctgcactgcctactttgagggatcgaggtgtgag
gtgaacaagtgcagccgctgtctcgaaggggcctgtgtggtcaacaagcagagtggggat
gtcacctgcaactgcacggatggccgggtggcccccagctgtctgacctgcgtcggccac
tgcagcaatggcggctcctgtaccatgaacagcaaaatgatgcctgagtgccagtgccca
ccccacatgacagggccccggtgtgaggagcacgtcttcagccagcagcagccaggacat
atagcctccatcctaatccctctgctgttgctgctgctgctggttctggtggccggagtg
gtattctggtataagcggcgagtccaaggggctaagggcttccagcaccaacggatgacc
aacggggccatgaacgtggagattggaaaccccacctacaagatgtacgaaggcggagag
cctgatgatgtgggaggcctactggacgctgactttgccctggaccctgacaagcccacc
aacttcaccaaccccgtgtatgccacactctacatggggggccatggcagtcgccactcc
ctggccagcacggacgagaagcgagaactcctgggccggggccctgaggacgagataggg
gaccccttggcatag

DBGET integrated database retrieval system