KEGG   Homo sapiens (human): 4036Help
Entry
4036              CDS       T01001                                 

Gene name
LRP2, DBS, GP330
Definition
(RefSeq) LDL receptor related protein 2
  KO
K06233  low density lipoprotein-related protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04340  Hedgehog signaling pathway
hsa04918  Thyroid hormone synthesis
hsa04979  Cholesterol metabolism
Disease
H00886  Donnai-Barrow syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    4036 (LRP2)
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    4036 (LRP2)
  09154 Digestive system
   04979 Cholesterol metabolism
    4036 (LRP2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    4036 (LRP2)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    4036 (LRP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ldl_recept_a Ldl_recept_b FXa_inhibition cEGF DUF5050 EGF_CA SGL
Motif
Other DBs
NCBI-GeneID: 4036
NCBI-ProteinID: NP_004516
OMIM: 600073
HGNC: 6694
Ensembl: ENSG00000081479
Vega: OTTHUMG00000132179
Pharos: P98164(Tbio)
UniProt: P98164 Q7Z5C1 Q7Z5C0
Structure
PDB: 

Position
2q31.1
AA seq 4655 aa AA seqDB search
MDRGPAAVACTLLLALVACLAPASGQECDSAHFRCGSGHCIPADWRCDGTKDCSDDADEI
GCAVVTCQQGYFKCQSEGQCIPNSWVCDQDQDCDDGSDERQDCSQSTCSSHQITCSNGQC
IPSEYRCDHVRDCPDGADENDCQYPTCEQLTCDNGACYNTSQKCDWKVDCRDSSDEINCT
EICLHNEFSCGNGECIPRAYVCDHDNDCQDGSDEHACNYPTCGGYQFTCPSGRCIYQNWV
CDGEDDCKDNGDEDGCESGPHDVHKCSPREWSCPESGRCISIYKVCDGILDCPGREDENN
TSTGKYCSMTLCSALNCQYQCHETPYGGACFCPPGYIINHNDSRTCVEFDDCQIWGICDQ
KCESRPGRHLCHCEEGYILERGQYCKANDSFGEASIIFSNGRDLLIGDIHGRSFRILVES
QNRGVAVGVAFHYHLQRVFWTDTVQNKVFSVDINGLNIQEVLNVSVETPENLAVDWVNNK
IYLVETKVNRIDMVNLDGSYRVTLITENLGHPRGIAVDPTVGYLFFSDWESLSGEPKLER
AFMDGSNRKDLVKTKLGWPAGVTLDMISKRVYWVDSRFDYIETVTYDGIQRKTVVHGGSL
IPHPFGVSLFEGQVFFTDWTKMAVLKANKFTETNPQVYYQASLRPYGVTVYHSLRQPYAT
NPCKDNNGGCEQVCVLSHRTDNDGLGFRCKCTFGFQLDTDERHCIAVQNFLIFSSQVAIR
GIPFTLSTQEDVMVPVSGNPSFFVGIDFDAQDSTIFFSDMSKHMIFKQKIDGTGREILAA
NRVENVESLAFDWISKNLYWTDSHYKSISVMRLADKTRRTVVQYLNNPRSVVVHPFAGYL
FFTDWFRPAKIMRAWSDGSHLLPVINTTLGWPNGLAIDWAASRLYWVDAYFDKIEHSTFD
GLDRRRLGHIEQMTHPFGLAIFGEHLFFTDWRLGAIIRVRKADGGEMTVIRSGIAYILHL
KSYDVNIQTGSNACNQPTHPNGDCSHFCFPVPNFQRVCGCPYGMRLASNHLTCEGDPTNE
PPTEQCGLFSFPCKNGRCVPNYYLCDGVDDCHDNSDEQLCGTLNNTCSSSAFTCGHGECI
PAHWRCDKRNDCVDGSDEHNCPTHAPASCLDTQYTCDNHQCISKNWVCDTDNDCGDGSDE
KNCNSTETCQPSQFNCPNHRCIDLSFVCDGDKDCVDGSDEVGCVLNCTASQFKCASGDKC
IGVTNRCDGVFDCSDNSDEAGCPTRPPGMCHSDEFQCQEDGICIPNFWECDGHPDCLYGS
DEHNACVPKTCPSSYFHCDNGNCIHRAWLCDRDNDCGDMSDEKDCPTQPFRCPSWQWQCL
GHNICVNLSVVCDGIFDCPNGTDESPLCNGNSCSDFNGGCTHECVQEPFGAKCLCPLGFL
LANDSKTCEDIDECDILGSCSQHCYNMRGSFRCSCDTGYMLESDGRTCKVTASESLLLLV
ASQNKIIADSVTSQVHNIYSLVENGSYIVAVDFDSISGRIFWSDATQGKTWSAFQNGTDR
RVVFDSSIILTETIAIDWVGRNLYWTDYALETIEVSKIDGSHRTVLISKNLTNPRGLALD
PRMNEHLLFWSDWGHHPRIERASMDGSMRTVIVQDKIFWPCGLTIDYPNRLLYFMDSYLD
YMDFCDYNGHHRRQVIASDLIIRHPYALTLFEDSVYWTDRATRRVMRANKWHGGNQSVVM
YNIQWPLGIVAVHPSKQPNSVNPCAFSRCSHLCLLSSQGPHFYSCVCPSGWSLSPDLLNC
LRDDQPFLITVRQHIIFGISLNPEVKSNDAMVPIAGIQNGLDVEFDDAEQYIYWVENPGE
IHRVKTDGTNRTVFASISMVGPSMNLALDWISRNLYSTNPRTQSIEVLTLHGDIRYRKTL
IANDGTALGVGFPIGITVDPARGKLYWSDQGTDSGVPAKIASANMDGTSVKTLFTGNLEH
LECVTLDIEEQKLYWAVTGRGVIERGNVDGTDRMILVHQLSHPWGIAVHDSFLYYTDEQY
EVIERVDKATGANKIVLRDNVPNLRGLQVYHRRNAAESSNGCSNNMNACQQICLPVPGGL
FSCACATGFKLNPDNRSCSPYNSFIVVSMLSAIRGFSLELSDHSETMVPVAGQGRNALHV
DVDVSSGFIYWCDFSSSVASDNAIRRIKPDGSSLMNIVTHGIGENGVRGIAVDWVAGNLY
FTNAFVSETLIEVLRINTTYRRVLLKVTVDMPRHIVVDPKNRYLFWADYGQRPKIERSFL
DCTNRTVLVSEGIVTPRGLAVDRSDGYVYWVDDSLDIIARIRINGENSEVIRYGSRYPTP
YGITVFENSIIWVDRNLKKIFQASKEPENTEPPTVIRDNINWLRDVTIFDKQVQPRSPAE
VNNNPCLENNGGCSHLCFALPGLHTPKCDCAFGTLQSDGKNCAISTENFLIFALSNSLRS
LHLDPENHSPPFQTINVERTVMSLDYDSVSDRIYFTQNLASGVGQISYATLSSGIHTPTV
IASGIGTADGIAFDWITRRIYYSDYLNQMINSMAEDGSNRTVIARVPKPRAIVLDPCQGY
LYWADWDTHAKIERATLGGNFRVPIVNSSLVMPSGLTLDYEEDLLYWVDASLQRIERSTL
TGVDREVIVNAAVHAFGLTLYGQYIYWTDLYTQRIYRANKYDGSGQIAMTTNLLSQPRGI
NTVVKNQKQQCNNPCEQFNGGCSHICAPGPNGAECQCPHEGNWYLANNRKHCIVDNGERC
GASSFTCSNGRCISEEWKCDNDNDCGDGSDEMESVCALHTCSPTAFTCANGRCVQYSYRC
DYYNDCGDGSDEAGCLFRDCNATTEFMCNNRRCIPREFICNGVDNCHDNNTSDEKNCPDR
TCQSGYTKCHNSNICIPRVYLCDGDNDCGDNSDENPTYCTTHTCSSSEFQCASGRCIPQH
WYCDQETDCFDASDEPASCGHSERTCLADEFKCDGGRCIPSEWICDGDNDCGDMSDEDKR
HQCQNQNCSDSEFLCVNDRPPDRRCIPQSWVCDGDVDCTDGYDENQNCTRRTCSENEFTC
GYGLCIPKIFRCDRHNDCGDYSDERGCLYQTCQQNQFTCQNGRCISKTFVCDEDNDCGDG
SDELMHLCHTPEPTCPPHEFKCDNGRCIEMMKLCNHLDDCLDNSDEKGCGINECHDPSIS
GCDHNCTDTLTSFYCSCRPGYKLMSDKRTCVDIDECTEMPFVCSQKCENVIGSYICKCAP
GYLREPDGKTCRQNSNIEPYLIFSNRYYLRNLTIDGYFYSLILEGLDNVVALDFDRVEKR
LYWIDTQRQVIERMFLNKTNKETIINHRLPAAESLAVDWVSRKLYWLDARLDGLFVSDLN
GGHRRMLAQHCVDANNTFCFDNPRGLALHPQYGYLYWADWGHRAYIGRVGMDGTNKSVII
STKLEWPNGITIDYTNDLLYWADAHLGYIEYSDLEGHHRHTVYDGALPHPFAITIFEDTI
YWTDWNTRTVEKGNKYDGSNRQTLVNTTHRPFDIHVYHPYRQPIVSNPCGTNNGGCSHLC
LIKPGGKGFTCECPDDFRTLQLSGSTYCMPMCSSTQFLCANNEKCIPIWWKCDGQKDCSD
GSDELALCPQRFCRLGQFQCSDGNCTSPQTLCNAHQNCPDGSDEDRLLCENHHCDSNEWQ
CANKRCIPESWQCDTFNDCEDNSDEDSSHCASRTCRPGQFRCANGRCIPQAWKCDVDNDC
GDHSDEPIEECMSSAHLCDNFTEFSCKTNYRCIPKWAVCNGVDDCRDNSDEQGCEERTCH
PVGDFRCKNHHCIPLRWQCDGQNDCGDNSDEENCAPRECTESEFRCVNQQCIPSRWICDH
YNDCGDNSDERDCEMRTCHPEYFQCTSGHCVHSELKCDGSADCLDASDEADCPTRFPDGA
YCQATMFECKNHVCIPPYWKCDGDDDCGDGSDEELHLCLDVPCNSPNRFRCDNNRCIYSH
EVCNGVDDCGDGTDETEEHCRKPTPKPCTEYEYKCGNGHCIPHDNVCDDADDCGDWSDEL
GCNKGKERTCAENICEQNCTQLNEGGFICSCTAGFETNVFDRTSCLDINECEQFGTCPQH
CRNTKGSYECVCADGFTSMSDRPGKRCAAEGSSPLLLLPDNVRIRKYNLSSERFSEYLQD
EEYIQAVDYDWDPKDIGLSVVYYTVRGEGSRFGAIKRAYIPNFESGRNNLVQEVDLKLKY
VMQPDGIAVDWVGRHIYWSDVKNKRIEVAKLDGRYRKWLISTDLDQPAAIAVNPKLGLMF
WTDWGKEPKIESAWMNGEDRNILVFEDLGWPTGLSIDYLNNDRIYWSDFKEDVIETIKYD
GTDRRVIAKEAMNPYSLDIFEDQLYWISKEKGEVWKQNKFGQGKKEKTLVVNPWLTQVRI
FHQLRYNKSVPNLCKQICSHLCLLRPGGYSCACPQGSSFIEGSTTECDAAIELPINLPPP
CRCMHGGNCYFDETDLPKCKCPSGYTGKYCEMAFSKGISPGTTAVAVLLTILLIVVIGAL
AIAGFFHYRRTGSLLPALPKLPSLSSLVKPSENGNGVTFRSGADLNMDIGVSGFGPETAI
DRSMAMSEDFVMEMGKQPIIFENPMYSARDSAVKVVQPIQVTVSENVDNKNYGSPINPSE
IVPETNPTSPAADGTQVTKWNLFKRKSKQTTNFENPIYAQMENEQKESVAATPPPSPSLP
AKPKPPSRRDPTPTYSATEDTFKDTANLVKEDSEV
NT seq 13968 nt NT seq  +upstreamnt  +downstreamnt
atggatcgcgggccggcagcagtggcgtgcacgctgctcctggctctcgtcgcctgccta
gcgccggccagtggccaagaatgtgacagtgcgcattttcgctgtggaagtgggcattgc
atccctgcagactggaggtgtgatgggaccaaagactgttcagatgacgcggatgaaatt
ggctgcgctgttgtgacctgccagcagggctatttcaagtgccagagtgagggacaatgc
atccccaactcctgggtgtgtgaccaagatcaagactgtgatgatggctcagatgaacgt
caagattgctcacaaagtacatgctcaagtcatcagataacatgctccaatggtcagtgt
atcccaagtgaatacaggtgcgaccacgtcagagactgccccgatggagctgatgagaat
gactgccagtacccaacatgtgagcagcttacttgtgacaatggggcctgctataacacc
agtcagaagtgtgattggaaagttgattgcagggactcctcagatgaaatcaactgcact
gagatatgcttgcacaatgagttttcatgtggcaatggagagtgtatccctcgtgcttat
gtctgtgaccatgacaatgattgccaagacggcagtgacgaacatgcttgcaactatccg
acctgcggtggttaccagttcacttgccccagtggccgatgcatttatcaaaactgggtt
tgtgatggagaagatgactgtaaagataatggagatgaagatggatgtgaaagcggtcct
catgatgttcataaatgttccccaagagaatggtcttgcccagagtcgggacgatgcatc
tccatttataaagtttgtgatgggattttagattgcccaggaagagaagatgaaaacaac
actagtaccggaaaatactgtagtatgactctgtgctctgccttgaactgccagtaccag
tgccatgagacgccgtatggaggagcgtgtttttgtcccccaggttatatcatcaaccac
aatgacagccgtacctgtgttgagtttgatgattgccagatatggggaatttgtgaccag
aagtgtgaaagccgacctggccgtcacctgtgccactgtgaagaagggtatatcttggag
cgtggacagtattgcaaagctaatgattcctttggcgaggcctccattatcttctccaat
ggtcgggatttgttaattggtgatattcatggaaggagcttccggatcctagtggagtct
cagaatcgtggagtggccgtgggtgtggctttccactatcacctgcaaagagttttttgg
acagacaccgtgcaaaataaggttttttcagttgacattaatggtttaaatatccaagag
gttctcaatgtttctgttgaaaccccagagaacctggctgtggactgggttaataataaa
atctatctagtggaaaccaaggtcaaccgcatagatatggtaaatttggatggaagctat
cgggttacccttataactgaaaacttggggcatcctagaggaattgccgtggacccaact
gttggttatttatttttctcagattgggagagcctttctggggaacctaagctggaaagg
gcattcatggatggcagcaaccgtaaagacttggtgaaaacaaagctgggatggcctgct
ggggtaactctggatatgatatcgaagcgtgtttactgggttgactctcggtttgattac
attgaaactgtaacttatgatggaattcaaaggaagactgtagttcatggaggctccctc
attcctcatccctttggagtaagcttatttgaaggtcaggtgttctttacagattggaca
aagatggccgtgctgaaggcaaacaagttcacagagaccaacccacaagtgtactaccag
gcttccctgaggccctatggagtgactgtttaccattccctcagacagccctatgctacc
aatccgtgtaaagataacaatgggggctgtgagcaggtctgtgtcctcagccacagaaca
gataatgatggtttgggtttccgttgcaagtgcacattcggcttccaactggatacagat
gagcgccactgcattgctgttcagaatttcctcattttttcatcccaagttgctattcgt
gggatcccgttcaccttgtctacccaggaagatgtcatggttccagtttcggggaatcct
tctttctttgtcgggattgattttgacgcccaggacagcactatctttttttcagatatg
tcaaaacacatgatttttaagcaaaagattgatggcacaggaagagaaattctcgcagct
aacagggtggaaaatgttgaaagtttggcttttgattggatttcaaagaatctctattgg
acagactctcattacaagagtatcagtgtcatgaggctagctgataaaacgagacgcaca
gtagttcagtatttaaataacccacggtcggtggtagttcatccttttgccgggtatcta
ttcttcactgattggttccgtcctgctaaaattatgagagcatggagtgacggatctcac
ctcttgcctgtaataaacactactcttggatggcccaatggcttggccatcgattgggct
gcttcacgattgtactgggtagatgcctattttgataaaattgagcacagcacctttgat
ggtttagacagaagaagactgggccatatagagcagatgacacatccgtttggacttgcc
atctttggagagcatttattttttactgactggagactgggtgccattattcgagtcagg
aaagcagatggtggagaaatgacagttatccgaagtggcattgcttacatactgcatttg
aaatcgtatgatgtcaacatccagactggttctaacgcctgtaatcaacccacgcatcct
aacggtgactgcagccacttctgcttcccggtgccaaatttccagcgagtgtgtgggtgc
ccttatggaatgaggctggcttccaatcacttgacatgcgagggggacccaaccaatgaa
ccacccacagagcagtgtggcttattttccttcccctgtaaaaatggcagatgtgtgccc
aattactatctctgtgatggagtcgatgattgtcatgataacagtgatgagcaactatgt
ggcacacttaataatacctgttcatcttcggcgttcacctgtggccatggggagtgcatt
cctgcacactggcgctgtgacaaacgcaacgactgtgtggatggcagtgatgagcacaac
tgccccacccacgcacctgcttcctgccttgacacccaatacacctgtgataatcaccag
tgtatctcaaagaactgggtctgtgacacagacaatgattgtggggatggatctgatgaa
aagaactgcaattcgacagagacatgccaacctagtcagtttaattgccccaatcatcga
tgtattgacctatcgtttgtctgtgatggtgacaaggattgtgttgatggatctgatgag
gttggttgtgtattaaactgtactgcttctcaattcaagtgtgccagtggggataaatgt
attggcgtcacaaatcgttgtgatggtgtttttgattgcagtgacaactcggatgaagca
ggctgtccaaccaggcctcctggtatgtgccactcagatgaatttcagtgccaagaagat
ggtatctgcatcccgaacttctgggaatgtgatgggcatccagactgcctctatggatct
gatgagcacaatgcctgtgtccccaagacttgcccttcatcatatttccactgtgacaac
ggaaactgcatccacagggcatggctctgtgatcgggacaatgactgcggggatatgagt
gatgagaaggactgccctactcagccctttcgctgtcctagttggcaatggcagtgtctt
ggccataacatctgtgtgaatctgagtgtagtgtgtgatggcatctttgactgccccaat
gggacagatgagtccccactttgcaatgggaacagctgctcagatttcaatggtggttgt
actcacgagtgtgttcaagagccctttggggctaaatgcctatgtccattgggattctta
cttgccaatgattctaagacctgtgaagacatagatgaatgtgatattctaggctcttgt
agccagcactgttacaatatgagaggttctttccggtgctcgtgtgatacaggctacatg
ttagaaagtgatgggaggacttgcaaagttacagcatctgagagtctgctgttacttgtg
gcaagtcagaacaaaattattgccgacagtgtcacctcccaggtccacaatatctattca
ttggtcgagaatggttcttacattgtagctgttgattttgattcaattagtggtcgtatc
ttttggtctgatgcaactcagggtaaaacctggagtgcgtttcaaaatggaacggacaga
agagtggtatttgacagtagcatcatcttgactgaaactattgcaatagattgggtaggt
cgtaatctttactggacagactatgctctggaaacaattgaagtctccaaaattgatggg
agccacaggactgtgctgattagtaaaaacctaacaaatccaagaggactagcattagat
cccagaatgaatgagcatctactgttctggtctgactggggccaccaccctcgcatcgag
cgagccagcatggacggcagcatgcgcactgtcattgtccaggacaagatcttctggccc
tgcggcttaactattgactaccccaacagactgctctacttcatggactcctatcttgat
tacatggacttttgtgattataatggacaccatcggagacaggtgatagccagtgatttg
attatacggcacccctatgccctaactctctttgaagactctgtgtactggactgaccgt
gctactcgtcgggttatgcgagccaacaagtggcatggagggaaccagtcagttgtaatg
tataatattcaatggccccttgggattgttgcggttcatccttcgaaacaaccaaattcc
gtgaatccatgtgccttttcccgctgcagccatctctgcctgctttcctcacaggggcct
catttttactcctgtgtttgtccttcaggatggagtctgtctcctgatctcctgaattgc
ttgagagatgatcaacctttcttaataactgtaaggcaacatataatttttggaatctcc
cttaatcctgaggtgaagagcaatgatgctatggtccccatagcagggatacagaatggt
ttagatgttgaatttgatgatgctgagcaatacatctattgggttgaaaatccaggtgaa
attcacagagtgaagacagatggcaccaacaggacagtatttgcttctatatctatggtg
gggccttctatgaacctggccttagattggatttcaagaaacctttattctaccaatcct
agaactcagtcaatcgaggttttgacactccacggagatatcagatacagaaaaacattg
attgccaatgatgggacagctcttggagttggctttccaattggcataactgttgatcct
gctcgtgggaagctgtactggtcagaccaaggaactgacagtggggttcctgccaagatc
gccagtgctaacatggatggcacatctgtgaaaactctctttactgggaacctcgaacac
ctggagtgtgtcactcttgacatcgaagagcagaaactctactgggcagtcactggaaga
ggagtgattgaaagaggaaacgtggatggaacagatcgaatgatcctggtacaccagctt
tcccacccctggggaattgcagtccatgattctttcctttattatactgatgaacagtat
gaggtcattgaaagagttgataaggccactggggccaacaaaatagtcttgagagataat
gttccaaatctgaggggtcttcaagtttatcacagacgcaatgccgccgaatcctcaaat
ggctgtagcaacaacatgaatgcctgtcagcagatttgcctgcctgtaccaggaggattg
ttttcctgcgcctgtgccactggatttaaactcaatcctgataatcggtcctgctctcca
tataactctttcattgttgtttcaatgctgtctgcaatcagaggctttagcttggaattg
tcagatcattcagaaaccatggtgccggtggcaggccaaggacgaaacgcactgcatgtg
gatgtggatgtgtcctctggctttatttattggtgtgattttagcagctcagtggcatct
gataatgcgatccgtagaattaaaccagatggatcttctctgatgaacattgtgacacat
ggaataggagaaaatggagtccggggtattgcagtggattgggtagcaggaaatctttat
ttcaccaatgcctttgtttctgaaacactgatagaagttctgcggatcaatactacttac
cgccgtgttcttcttaaagtcacagtggacatgcctaggcatattgttgtagatcccaag
aacagatacctcttctgggctgactatgggcagagaccaaagattgagcgttctttcctt
gactgtaccaatcgaacagtgcttgtgtcagagggcattgtcacaccacggggcttggca
gtggaccgaagtgatggctacgtttattgggttgatgattctttagatataattgcaagg
attcgtatcaatggagagaactctgaagtgattcgttatggcagtcgttacccaactcct
tatggcatcactgtttttgaaaattctatcatatgggtagataggaatttgaaaaagatc
ttccaagccagcaaggaaccagagaacacagagccacccacagtgataagagacaatatc
aactggctaagagatgtgaccatctttgacaagcaagtccagccccggtcaccagcagag
gtcaacaacaacccttgcttggaaaacaatggtgggtgctctcatctctgctttgctctg
cctggattgcacaccccaaaatgtgactgtgcctttgggaccctgcaaagtgatggcaag
aattgtgccatttcaacagaaaatttcctcatctttgccttgtctaattccttgagaagc
ttacacttggaccctgaaaaccatagcccacctttccaaacaataaatgtggaaagaact
gtcatgtctctagactatgacagtgtaagtgatagaatctacttcacacaaaatttagcc
tctggagttggacagatttcctatgccaccctgtcttcagggatccatactccaactgtc
attgcttcaggtatagggactgctgatggcattgcctttgactggattactagaagaatt
tattacagtgactacctcaaccagatgattaattccatggctgaagatgggtctaaccgc
actgtgatagcccgcgttccaaaaccaagagcaattgtgttagatccctgccaagggtac
ctgtactgggctgactgggatacacatgccaaaatcgagagagccacattgggaggaaac
ttccgcgtacccattgtgaacagcagtctggtcatgcccagtgggctgactctggactat
gaagaggaccttctctactgggtggatgctagtctgcagaggattgaacgcagcactctg
acgggcgtggatcgtgaagtcattgtcaatgcagccgttcatgcttttggcttgactctc
tatggccagtatatttactggactgacttgtacacacaaagaatttaccgagctaacaaa
tatgacgggtcaggtcagattgcaatgaccacaaatttgctctcccagcccaggggaatc
aacactgttgtgaagaaccagaaacaacagtgtaacaatccttgtgaacagtttaatggg
ggctgcagccatatctgtgcaccaggtccaaatggtgccgagtgccagtgtccacatgag
ggcaactggtatttggccaacaacaggaagcactgcattgtggacaatggtgaacgatgt
ggtgcatcttccttcacctgctccaatgggcgctgcatctcggaagagtggaagtgtgat
aatgacaacgactgtggggatggcagtgatgagatggaaagtgtctgtgcacttcacacc
tgctcaccgacagccttcacctgtgccaatgggcgatgtgtccaatactcttaccgctgt
gattactacaatgactgtggtgatggcagtgatgaggcagggtgcctgttcagggactgc
aatgccaccacggagtttatgtgcaataacagaaggtgcatacctcgtgagtttatctgc
aatggtgtagacaactgccatgataataacacttcagatgagaaaaattgccctgatcgc
acttgccagtctggatacacaaaatgtcataattcaaatatttgtattcctcgcgtttat
ttgtgtgacggagacaatgactgtggagataacagtgatgaaaaccctacttattgcacc
actcacacgtgcagcagcagtgagttccaatgcgcatctgggcgctgtattcctcaacat
tggtattgtgatcaagaaacagattgttttgatgcctctgatgaacctgcctcttgtggt
cactctgagcgaacatgcctagctgatgagttcaagtgtgatggtgggaggtgcatccca
agcgaatggatctgtgacggtgataatgactgtggggatatgagtgacgaggataaaagg
caccagtgtcagaatcaaaactgctcggattccgagtttctctgtgtaaatgacagacct
ccggacaggaggtgcattccccagtcttgggtctgtgatggcgatgtggattgtactgac
ggctacgatgagaatcagaattgcaccaggagaacttgctctgaaaatgaattcacctgt
ggttacggactgtgtatcccaaagatattcaggtgtgaccggcacaatgactgtggtgac
tatagcgacgagaggggctgcttataccagacttgccaacagaatcagtttacctgtcag
aacgggcgctgcattagtaaaaccttcgtctgtgatgaggataatgactgtggagacgga
tctgatgagctgatgcacctgtgccacaccccagaacccacgtgtccacctcacgagttc
aagtgtgacaatgggcgctgcatcgagatgatgaaactctgcaaccacctagatgactgt
ttggacaacagcgatgagaaaggctgtggcattaatgaatgccatgacccttcaatcagt
ggctgcgatcacaactgcacagacaccttaaccagtttctattgttcctgtcgtcctggt
tacaagctcatgtctgacaagcggacttgtgttgatattgatgaatgcacagagatgcct
tttgtctgtagccagaagtgtgagaatgtaataggctcctacatctgtaagtgtgcccca
ggctacctccgagaaccagatggaaagacctgccggcaaaacagtaacatcgaaccctat
ctcatttttagcaaccgttactatttgagaaatttaactatagatggctatttttactcc
ctcatcttggaaggactggacaatgttgtggcattagattttgaccgagtagagaagaga
ttgtattggattgatacacagaggcaagtcattgagagaatgtttctgaataagacaaac
aaggagacaatcataaaccacagactaccagctgcagaaagtctggctgtagactgggtt
tccagaaagctctactggttggatgcccgcctggatggcctctttgtctctgacctcaat
ggtggacaccgccgcatgctggcccagcactgtgtggatgccaacaacaccttctgcttt
gataatcccagaggacttgcccttcaccctcaatatgggtacctctactgggcagactgg
ggtcaccgcgcatacattgggagagtaggcatggatggaaccaacaagtctgtgataatc
tccaccaagttagagtggcctaatggcatcaccattgattacaccaatgatctactctac
tgggcagatgcccacctgggttacatagagtactctgatttggagggccaccatcgacac
acggtgtatgatggggcactgcctcaccctttcgctattaccatttttgaagacactatt
tattggacagattggaatacaaggacagtggaaaagggaaacaaatatgatggatcaaat
agacagacactggtgaacacaacacacagaccatttgacatccatgtgtaccatccatat
aggcagcccattgtgagcaatccctgtggtaccaacaatggtggctgttctcatctctgc
ctcatcaagccaggaggaaaagggttcacttgcgagtgtccagatgacttccgcaccctt
cagctgagtggcagcacctactgcatgcccatgtgctccagcacccagttcctgtgcgct
aacaatgaaaagtgcattcctatctggtggaaatgtgatggacagaaagactgctcagat
ggctctgatgaactggccctttgcccgcagcgcttctgccgactgggacagttccagtgc
agtgacggcaactgcaccagcccgcagactttatgcaatgctcaccaaaattgccctgat
gggtctgatgaagaccgtcttctttgtgagaatcaccactgtgactccaatgaatggcag
tgcgccaacaaacgttgcatcccagaatcctggcagtgtgacacatttaacgactgtgag
gataactcagatgaagacagttcccactgtgccagcaggacctgccggccgggccagttt
cggtgtgctaatggccgctgcatcccgcaggcctggaagtgtgatgtggataatgattgt
ggagaccactcggatgagcccattgaagaatgcatgagctctgcccatctctgtgacaac
ttcacagaattcagctgcaaaacaaattaccgctgcatcccaaagtgggccgtgtgcaat
ggtgtagatgactgcagggacaacagtgatgagcaaggctgtgaggagaggacatgccat
cctgtgggggatttccgctgtaaaaatcaccactgcatccctcttcgttggcagtgtgat
gggcaaaatgactgtggagataactcagatgaggaaaactgtgctccccgggagtgcaca
gagagcgagtttcgatgtgtcaatcagcagtgcattccctcgcgatggatctgtgaccat
tacaacgactgtggggacaactcagatgaacgggactgtgagatgaggacctgccatcct
gaatattttcagtgtacaagtggacattgtgtacacagtgaactgaaatgcgatggatcc
gctgactgtttggatgcgtctgatgaagctgattgtcccacacgctttcctgatggtgca
tactgccaggctactatgttcgaatgcaaaaaccatgtttgtatcccgccatattggaaa
tgtgatggcgatgatgactgtggcgatggttcagatgaagaacttcacctgtgcttggat
gttccctgtaattcaccaaaccgtttccggtgtgacaacaatcgctgcatttatagtcat
gaggtgtgcaatggtgtggatgactgtggagatggaactgatgagacagaggagcactgt
agaaaaccgacccctaaaccttgtacagaatatgaatataagtgtggcaatgggcattgc
attccacatgacaatgtgtgtgatgatgccgatgactgtggtgactggtccgatgaactg
ggttgcaataaaggaaaagaaagaacatgtgctgaaaatatatgcgagcaaaattgtacc
caattaaatgaaggaggatttatctgctcctgtacagctgggttcgaaaccaatgttttt
gacagaacctcctgtctagatatcaatgaatgtgaacaatttgggacttgtccccagcac
tgcagaaataccaaaggaagttatgagtgtgtctgtgctgatggcttcacgtctatgagt
gaccgccctggaaaacgatgtgcagctgagggtagctctcctttgttgctactgcctgac
aatgtccgaattcgaaaatataatctctcatctgagaggttctcagagtatcttcaagat
gaggaatatatccaagctgttgattatgattgggatcccaaggacataggcctcagtgtt
gtgtattacactgtgcgaggggagggctctaggtttggtgctatcaaacgtgcctacatc
cccaactttgaatccggccgcaataatcttgtgcaggaagttgacctgaaactgaaatac
gtaatgcagccagatggaatagcagtggactgggttggaaggcatatttactggtcagat
gtcaagaataaacgcattgaggtggctaaacttgatggaaggtacagaaagtggctgatt
tccactgacctggaccaaccagctgctattgctgtgaatcccaaactagggcttatgttc
tggactgactggggaaaggaacctaaaatcgagtctgcctggatgaatggagaggaccgc
aacatcctggttttcgaggaccttggttggccaactggcctttctatcgattatttgaac
aatgaccgaatctactggagtgacttcaaggaggacgttattgaaaccataaaatatgat
gggactgataggagagtcattgcaaaggaagcaatgaacccttacagcctggacatcttt
gaagaccagttatactggatatctaaggaaaagggagaagtatggaaacaaaataaattt
gggcaaggaaagaaagagaaaacgctggtagtgaacccttggctcactcaagttcgaatc
tttcatcaactcagatacaataagtcagtgcccaacctttgcaaacagatctgcagccac
ctctgccttctgagacctggaggatacagctgtgcctgtccccaaggctccagctttata
gaggggagcaccactgagtgtgatgcagccatcgaactgcctatcaacctgcccccccca
tgcaggtgcatgcacggaggaaattgctattttgatgagactgacctccccaaatgcaag
tgtcctagcggctacaccggaaaatattgtgaaatggcgttttcaaaaggcatctctcca
ggaacaaccgcagtagctgtgctgttgacaatcctcttgatcgtcgtaattggagctctg
gcaattgcaggattcttccactatagaaggaccggctcccttttgcctgctctgcccaag
ctgccaagcttaagcagtctcgtcaagccctctgaaaatgggaatggggtgaccttcaga
tcaggggcagatcttaacatggatattggagtgtctggttttggacctgagactgctatt
gacaggtcaatggcaatgagtgaagactttgtcatggaaatggggaagcagcccataata
tttgaaaacccaatgtactcagccagagacagtgctgtcaaagtggttcagccaatccag
gtgactgtatctgaaaatgtggataataagaattatggaagtcccataaacccttctgag
atagttccagagacaaacccaacttcaccagctgctgatggaactcaggtgacaaaatgg
aatctcttcaaacgaaaatctaaacaaactaccaactttgaaaatccaatctatgcacag
atggagaacgagcaaaaggaaagtgttgctgcgacaccacctccatcaccttcgctccct
gctaagcctaagcctccttcgagaagagacccaactccaacctattctgcaacagaagac
acttttaaagacaccgcaaatcttgttaaagaagactctgaagtatag

DBGET integrated database retrieval system