KEGG   Homo sapiens (human): 404203Help
Entry
404203            CDS       T01001                                 

Gene name
SPINK6, BUSI2, UNQ844
Definition
(RefSeq) serine peptidase inhibitor, Kazal type 6
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Kazal_1 Kazal_2 Uteroglobin GPR15L DUF35_N
Motif
Other DBs
NCBI-GeneID: 404203
NCBI-ProteinID: NP_001182219
OMIM: 615868
HGNC: 29486
Ensembl: ENSG00000178172
Vega: OTTHUMG00000163425
Pharos: Q6UWN8(Tdark)
UniProt: Q6UWN8
Structure
PDB: 

Position
5q32
AA seq 80 aa AA seqDB search
MKLSGMFLLLSLALFCFLTGVFSQGGQVDCGEFQDPKVYCTRESNPHCGSDGQTYGNKCA
FCKAIVKSGGKISLKHPGKC
NT seq 243 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtcaggcatgtttctgctcctctctctggctcttttctgctttttaacaggt
gtcttcagtcagggaggacaggttgactgtggtgagttccaggaccccaaggtctactgc
actcgggaatctaacccacactgtggctctgatggccagacatatggcaataaatgtgcc
ttctgtaaggccatagtgaaaagtggtggaaagattagcctaaagcatcctggaaaatgc
tga

DBGET integrated database retrieval system