KEGG   Homo sapiens (human): 404220
Entry
404220            CDS       T01001                                 

Gene name
C6orf201, dJ1013A10.5
Definition
(RefSeq) chromosome 6 open reading frame 201
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: DUF4523 Imm70 Neprosin_AP
Other DBs
NCBI-GeneID: 404220
NCBI-ProteinID: NP_001078870
HGNC: 21620
Ensembl: ENSG00000185689
Vega: OTTHUMG00000014160
Pharos: Q7Z4U5(Tdark)
UniProt: Q7Z4U5 B3KW47
Position
6p25.2
AA seq 140 aa
MLSNLHELLPNHLMETLYSRKSEEDKKKCENPELSGLERILARHQLPKEINLTPKPNRMP
PWKRKIINNVTDGWKKCHLLKRNTKEPPMSTIVVRKLIQKNVPRRHSLRNTSRKLRNLPT
TAKGTQTGKSQCLLGISEPT
NT seq 423 nt   +upstreamnt  +downstreamnt
atgctgtctaacctccacgagctgcttccgaatcacctgatggagacgctttattcccgc
aagagtgaagaggacaagaaaaaatgtgagaatcctgaactctctggcttagaaagaatc
ttagcaagacatcagttgccaaaagagattaatctgaccccaaagccgaacagaatgccc
ccgtggaaaagaaaaatcatcaacaatgtaactgacgggtggaagaaatgtcacttgttg
aagagaaacacgaaagagcctccaatgtccaccatagttgtcagaaaacttattcaaaaa
aatgtacccagaagacacagcctaaggaatacaagcaggaaactgagaaacctgccaaca
acagctaaagggacacaaacaggaaaatcacagtgccttctgggtatatcagaacctacc
tga

DBGET integrated database retrieval system