KEGG   Homo sapiens (human): 404550
Entry
404550            CDS       T01001                                 
Symbol
C16orf74
Name
(RefSeq) chromosome 16 open reading frame 74
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: DUF4597
Other DBs
NCBI-GeneID: 404550
NCBI-ProteinID: NP_996850
HGNC: 23362
Ensembl: ENSG00000154102
Pharos: Q96GX8(Tdark)
UniProt: Q96GX8 A0A0M5MPK6
Position
16:complement(85707517..85751096)
AA seq 76 aa
MGLKMSCLKGFQMCVSSSSSSHDEAPVLNDKHLDVPDIIITPPTPTGMMLPRDLGSTVWL
DETGSCPDDGEIDPEA
NT seq 231 nt   +upstreamnt  +downstreamnt
atggggcttaagatgtcctgcctgaaaggctttcaaatgtgtgtcagcagcagcagcagc
agccacgacgaggcccccgtcctgaacgacaagcacctggacgtgcccgacatcatcatc
acgccccccacccccacgggcatgatgctgccgagggacttggggagcacagtctggctg
gatgagacagggtcgtgcccagatgatggagaaatcgacccagaagcctga

DBGET integrated database retrieval system