KEGG   Homo sapiens (human): 4046
Entry
4046              CDS       T01001                                 

Gene name
LSP1, WP34, pp52
Definition
(RefSeq) lymphocyte specific protein 1
  KO
K14957  lymphocyte-specific protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04625  C-type lectin receptor signaling pathway
hsa05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    4046 (LSP1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    4046 (LSP1)
SSDB
Motif
Pfam: Caldesmon DUF45
Other DBs
NCBI-GeneID: 4046
NCBI-ProteinID: NP_002330
OMIM: 153432
HGNC: 6707
Ensembl: ENSG00000130592
Vega: OTTHUMG00000012252
Pharos: P33241(Tbio)
UniProt: P33241
Position
11p15.5
AA seq 339 aa
MAEASSDPGAEEREELLGPTAQWSVEDEEEAVHEQCQHERDRQLQAQDEEGGGHVPERPK
QEMLLSLKPSEAPELDEDEGFGDWSQRPEQRQQHEGAQGALDSGEPPQCRSPEGEQEDRP
GLHAYEKEDSDEVHLEELSLSKEGPGPEDTVQDNLGAAGAEEEQEEHQKCQQPRTPSPLV
LEGTIEQSSPPLSPTTKLIDRTESLNRSIEKSNSVKKSQPDLPISKIDQWLEQYTQAIET
AGRTPKLARQASIELPSMAVASTKSRWETGEVQAQSAAKTPSCKDIVAGDMSKKSLWEQK
GGSKTSSTIKSTPSGKRYKFVATGHGKYEKVLVEGGPAP
NT seq 1020 nt   +upstreamnt  +downstreamnt
atggcggaggcttcgagtgacccgggtgccgaggagcgggaagagttgctggggcccact
gctcagtggagcgtggaggacgaggaggaggccgtccacgagcaatgccagcatgagaga
gacaggcagcttcaggcccaggacgaggagggaggcggccatgtccccgagcggccgaag
caggagatgctcctcagcctgaagccctcggaggcccctgaactggatgaggacgagggc
tttggcgactggtcccagaggccagagcagcggcagcagcacgagggggcgcagggcgcc
ttggacagcggagagcccccccagtgcaggagtcctgagggggagcaagaggacaggccc
ggcctgcatgcctacgaaaaggaggacagtgatgaagtccacctggaggagttgagtctg
agcaaggaggggccaggcccagaggacactgtccaggacaacctgggggccgcaggggct
gaggaggaacaggaggagcaccagaaatgtcagcagcccaggacacccagccccttggtc
ttggaggggaccatcgaacagagctcgcctcccctgagccctaccaccaaactcatcgac
aggaccgagtccctaaaccgctccatagagaagagtaacagtgtgaagaaatcccagcca
gacttgcccatctccaagattgatcagtggctggaacaatacacccaggccatcgagacc
gctggccggacccccaagctagcccgccaggcctccatagagctgcccagcatggctgtg
gccagtaccaagagtcggtgggagacgggtgaggtacaggctcagtctgcggccaagact
ccgtcctgcaaggatattgtggctggagacatgagcaagaaaagcctctgggagcagaag
ggaggctccaagacctcatcaacaattaagagcaccccatctgggaagaggtataagttt
gtggccaccgggcatgggaagtatgagaaggtgcttgtggaagggggcccggctccctag

DBGET integrated database retrieval system