KEGG   Homo sapiens (human): 4049Help
Entry
4049              CDS       T01001                                 

Gene name
LTA, LT, TNFB, TNFSF1, TNLG1E
Definition
(RefSeq) lymphotoxin alpha
  KO
K05468  lymphotoxin alpha (TNF superfamily, member 1)
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04064  NF-kappa B signaling pathway
hsa04668  TNF signaling pathway
hsa04940  Type I diabetes mellitus
hsa05166  Human T-cell leukemia virus 1 infection
hsa05168  Herpes simplex infection
Disease
H00344  Leprosy
Drug target
Etanercept: D00742
Lenercept: D04690
Pateclizumab: D10187
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    4049 (LTA)
   04668 TNF signaling pathway
    4049 (LTA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    4049 (LTA)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04940 Type I diabetes mellitus
    4049 (LTA)
  09172 Infectious diseases: Viral
   05166 Human T-cell leukemia virus 1 infection
    4049 (LTA)
   05168 Herpes simplex infection
    4049 (LTA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    4049 (LTA)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Tumor necrosis fators
   4049 (LTA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNF
Motif
Other DBs
NCBI-GeneID: 4049
NCBI-ProteinID: NP_000586
OMIM: 153440
HGNC: 6709
Ensembl: ENSG00000226979
Vega: OTTHUMG00000031135
Pharos: P01374(Tbio)
UniProt: P01374 Q5STV3
Structure
PDB: 

Position
6p21.33
AA seq 205 aa AA seqDB search
MTPPERLFLPRVCGTTLHLLLLGLLLVLLPGAQGLPGVGLTPSAAQTARQHPKMHLAHST
LKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAY
SPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQ
LSTHTDGIPHLVLSPSTVFFGAFAL
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgacaccacctgaacgtctcttcctcccaagggtgtgtggcaccaccctacacctcctc
cttctggggctgctgctggttctgctgcctggggcccaggggctccctggtgttggcctc
acaccttcagctgcccagactgcccgtcagcaccccaagatgcatcttgcccacagcacc
ctcaaacctgctgctcacctcattggagaccccagcaagcagaactcactgctctggaga
gcaaacacggaccgtgccttcctccaggatggtttctccttgagcaacaattctctcctg
gtccccaccagtggcatctacttcgtctactcccaggtggtcttctctgggaaagcctac
tctcccaaggccacctcctccccactctacctggcccatgaggtccagctcttctcctcc
cagtaccccttccatgtgcctctcctcagctcccagaagatggtgtatccagggctgcag
gaaccctggctgcactcgatgtaccacggggctgcgttccagctcacccagggagaccag
ctatccacccacacagatggcatcccccacctagtcctcagccctagtactgtcttcttt
ggagccttcgctctgtag

DBGET integrated database retrieval system