KEGG   Homo sapiens (human): 405Help
Entry
405               CDS       T01001                                 

Gene name
ARNT, HIF-1-beta, HIF-1beta, HIF1-beta, HIF1B, HIF1BETA, TANGO, bHLHe2
Definition
(RefSeq) aryl hydrocarbon receptor nuclear translocator
  KO
K09097  aryl hydrocarbon receptor nuclear translocator
Organism
hsa  Homo sapiens (human)
Pathway
hsa04066  HIF-1 signaling pathway
hsa04934  Cushing syndrome
hsa05200  Pathways in cancer
hsa05204  Chemical carcinogenesis
hsa05211  Renal cell carcinoma
Network
N00079  HIF-1 signaling pathway
N00080  Loss of VHL to HIF-1 signaling pathway
N00081  Mutation-inactivated VHL to HIF-1 signaling pathway
N00317  Aryl hydrocarbon receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    405 (ARNT)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    405 (ARNT)
   05204 Chemical carcinogenesis
    405 (ARNT)
  09162 Cancers: Specific types
   05211 Renal cell carcinoma
    405 (ARNT)
  09167 Endocrine and metabolic diseases
   04934 Cushing syndrome
    405 (ARNT)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    405 (ARNT)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    405 (ARNT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAS_3 PAS PAS_11 HLH PAS_9 PAS_4 PRAS
Motif
Other DBs
NCBI-GeneID: 405
NCBI-ProteinID: NP_001659
OMIM: 126110
HGNC: 700
Ensembl: ENSG00000143437
Vega: OTTHUMG00000035011
Pharos: P27540(Tbio)
UniProt: P27540
Structure
PDB: 

Position
1q21.3
AA seq 789 aa AA seqDB search
MAATTANPEMTSDVPSLGPAIASGNSGPGIQGGGAIVQRAIKRRPGLDFDDDGEGNSKFL
RCDDDQMSNDKERFARSDDEQSSADKERLARENHSEIERRRRNKMTAYITELSDMVPTCS
ALARKPDKLTILRMAVSHMKSLRGTGNTSTDGSYKPSFLTDQELKHLILEAADGFLFIVS
CETGRVVYVSDSVTPVLNQPQSEWFGSTLYDQVHPDDVDKLREQLSTSENALTGRILDLK
TGTVKKEGQQSSMRMCMGSRRSFICRMRCGSSSVDPVSVNRLSFVRNRCRNGLGSVKDGE
PHFVVVHCTGYIKAWPPAGVSLPDDDPEAGQGSKFCLVAIGRLQVTSSPNCTDMSNVCQP
TEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCHPEDQQLLRDSFQQVVKLKG
QVLSVMFRFRSKNQEWLWMRTSSFTFQNPYSDEIEYIICTNTNVKNSSQEPRPTLSNTIQ
RPQLGPTANLPLEMGSGQLAPRQQQQQTELDMVPGRDGLASYNHSQVVQPVTTTGPEHSK
PLEKSDGLFAQDRDPRFSEIYHNINADQSKGISSSTVPATQQLFSQGNTFPPTPRPAENF
RNSGLAPPVTIVQPSASAGQMLAQISRHSNPTQGATPTWTPTTRSGFSAQQVATQATAKT
RTSQFGVGSFQTPSSFSSMSLPGAPTASPGAAAYPSLTNRGSNFAPETGQTAGQFQTRTA
EGVGVWPQWQGQQPHHRSSSSEQHVQQPPAQQPGQPEVFQEMLSMLGDQSNSYNNEEFPD
LTMFPPFSE
NT seq 2370 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgactactgccaaccccgaaatgacatcagatgtaccatcactgggtccagcc
attgcctctggaaactctggacctggaattcaaggtggaggagccattgtccagagggct
attaagcggcgaccagggctggattttgatgatgatggagaagggaacagtaaatttttg
aggtgtgatgatgatcagatgtctaacgataaggagcggtttgccaggtcggatgatgag
cagagctctgcggataaagagagacttgccagggaaaatcacagtgaaattgaacggcgg
cgacggaacaagatgacagcctacatcacagaactgtcagatatggtacccacctgtagt
gccctggctcgaaaaccagacaagctaaccatcttacgcatggcagtttctcacatgaag
tccttgcggggaactggcaacacatccactgatggctcctataagccgtctttcctcact
gatcaggaactgaaacatttgatcttggaggcagcagatggctttctgtttattgtctca
tgtgagacaggcagggtggtgtatgtgtctgactccgtgactcctgttttgaaccagcca
cagtctgaatggtttggcagcacactctatgatcaggtgcacccagatgatgtggataaa
cttcgtgagcagctttccacttcagaaaatgccctgacagggcgtatcctggatctaaag
actggaacagtgaaaaaggaaggtcagcagtcttccatgagaatgtgtatgggctcaagg
agatcgtttatttgccgaatgaggtgtggcagtagctctgtggacccagtttctgtgaat
aggctgagctttgtgaggaacagatgcaggaatggacttggctctgtaaaggatggggaa
cctcacttcgtggtggtccactgcacaggctacatcaaggcctggcccccagcaggtgtt
tccctcccagatgatgacccagaggctggccagggaagcaagttttgcctagtggccatt
ggcagattgcaggtaactagttctcccaactgtacagacatgagtaatgtttgtcaacca
acagagttcatctcccgacacaacattgagggtatcttcacttttgtggatcaccgctgt
gtggctactgttggctaccagccacaggaactcttaggaaagaatattgtagaattctgt
catcctgaagaccagcagcttctaagagacagcttccaacaggtagtgaaattaaaaggc
caagtgctgtctgtcatgttccggttccggtctaagaaccaagaatggctctggatgaga
accagctcctttactttccagaacccttactcagatgaaattgagtacatcatctgtacc
aacaccaatgtgaagaactctagccaagaaccacggcctacactctccaacacaatccag
aggccacaactaggtcccacagctaatttacccctggagatgggctcaggacagctggca
cccaggcagcagcaacagcaaacagaattggacatggtaccaggaagagatggactggcc
agctacaatcattcccaggtggttcagcctgtgacaaccacaggaccagaacacagcaag
ccccttgagaagtcagatggtttatttgcccaggatagagatccaagattttcagaaatc
tatcacaacatcaatgcggatcagagtaaaggcatctcctccagcactgtccctgccacc
caacagctattctcccagggcaacacattccctcctaccccccggccggcagagaatttc
aggaatagtggcctagcccctcctgtaaccattgtccagccatcagcttctgcaggacag
atgttggcccagatttcccgccactccaaccccacccaaggagcaaccccaacttggacc
cctactacccgctcaggcttttctgcccagcaggtggctacccaggctactgctaagact
cgtacttcccagtttggtgtgggcagctttcagactccatcctccttcagctccatgtcc
ctccctggtgccccaactgcatcgcctggtgctgctgcctaccctagtctcaccaatcgt
ggatctaactttgctcctgagactggacagactgcaggacaattccagacacggacagca
gagggtgtgggtgtctggccacagtggcagggccagcagcctcatcatcgttcaagttct
agtgagcaacatgttcaacaaccgccagcacagcaacctggccagcctgaggtcttccag
gagatgctgtccatgctgggagatcagagcaacagctacaacaatgaagaattccctgat
ctaactatgtttccccccttttcagaatag

KEGG   Homo sapiens (human): 9915Help
Entry
9915              CDS       T01001                                 

Gene name
ARNT2, WEDAS, bHLHe1
Definition
(RefSeq) aryl hydrocarbon receptor nuclear translocator 2
  KO
K15589  aryl hydrocarbon receptor nuclear translocator 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05211  Renal cell carcinoma
Network
N00136  EWSR1-ATF1 fusion to transcriptional activation
Disease
H01797  Webb-Dattani syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    9915 (ARNT2)
   05202 Transcriptional misregulation in cancer
    9915 (ARNT2)
  09162 Cancers: Specific types
   05211 Renal cell carcinoma
    9915 (ARNT2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    9915 (ARNT2)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    9915 (ARNT2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAS_3 PAS PAS_11 HLH PAS_9 PAS_4 PAS_2
Motif
Other DBs
NCBI-GeneID: 9915
NCBI-ProteinID: NP_055677
OMIM: 606036
HGNC: 16876
Ensembl: ENSG00000172379
Vega: OTTHUMG00000165478
Pharos: Q9HBZ2(Tbio)
UniProt: Q9HBZ2 X5DQN9 Q7Z3A3 Q86TN1
Position
15q25.1
AA seq 717 aa AA seqDB search
MATPAAVNPPEMASDIPGSVTLPVAPMAATGQVRMAGAMPARGGKRRSGMDFDDEDGEGP
SKFSRENHSEIERRRRNKMTQYITELSDMVPTCSALARKPDKLTILRMAVSHMKSMRGTG
NKSTDGAYKPSFLTEQELKHLILEAADGFLFVVAAETGRVIYVSDSVTPVLNQPQSEWFG
STLYEQVHPDDVEKLREQLCTSENSMTGRILDLKTGTVKKEGQQSSMRMCMGSRRSFICR
MRCGNAPLDHLPLNRITTMRKRFRNGLGPVKEGEAQYAVVHCTGYIKAWPPAGMTIPEED
ADVGQGSKYCLVAIGRLQVTSSPVCMDMNGMSVPTEFLSRHNSDGIITFVDPRCISVIGY
QPQDLLGKDILEFCHPEDQSHLRESFQQVVKLKGQVLSVMYRFRTKNREWMLIRTSSFTF
QNPYSDEIEYIICTNTNVKQLQQQQAELEVHQRDGLSSYDLSQVPVPNLPAGVHEAGKSV
EKADAIFSQERDPRFAEMFAGISASEKKMMSSASAAGTQQIYSQGSPFPSGHSGKAFSSS
VVHVPGVNDIQSSSSTGQNMSQISRQLNQSQVAWTGSRPPFPGQQIPSQSSKTQSSPFGI
GTSHTYPADPSSYSPLSSPATSSPSGNAYSSLANRTPGFAESGQSSGQFQGRPSEVWSQW
QSQHHGQQSGEQHSHQQPGQTEVFQDMLPMPGDPTQGTGNYNIEDFADLGMFPPFSE
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccccggcggcggtcaaccctccggaaatggcttcagacatacctggatctgtg
acgttgcccgttgcccccatggcggccaccggacaggtgaggatggcgggggccatgcct
gcccgtggaggaaagcggcgttccggaatggacttcgatgatgaagatggtgaaggcccc
agtaaattttcaagagagaatcatagtgaaatcgaaaggcgcagacggaacaagatgact
cagtacatcacggagctctccgacatggtccccacatgcagcgcactggctcggaagcca
gacaagctcaccatcctccgcatggccgtctcgcacatgaagtccatgaggggtacaggg
aacaagtccaccgatggcgcgtacaagccttccttcctcacagagcaggaactgaagcat
ctcatccttgaagcagctgatggatttctgtttgtggtggctgctgagacagggcgagtg
atttatgtgtctgactccgtcacccctgttctgaaccagccccagtcagagtggtttggg
agcacactgtatgaacaggtgcatcctgatgacgtggagaagctgagagagcaactgtgc
acctcagaaaactcaatgacaggccggatcttggacctgaagactgggacggtcaagaaa
gaagggcagcagtcatccatgaggatgtgcatgggctcgcggcggtctttcatctgcagg
atgaggtgtggaaatgctcctttggaccaccttcctctaaacagaataaccaccatgagg
aaaaggttcaggaatggccttggccctgtgaaagaaggagaagcccaatatgctgtggtc
cactgtacaggatacatcaaggcctggccaccagcaggaatgaccatacctgaagaagac
gctgatgtgggacaaggcagtaaatattgcctcgtggcaattgggagactccaggtgacc
agctctcctgtatgcatggacatgaatgggatgtcggtgcccacagagttcttatcccgg
cataactccgatggaatcatcacatttgtggatccaagatgtatcagtgtgattggctac
caaccccaggatcttctgggaaaggacattttggaattctgccaccctgaggatcaaagc
catctgcgtgagagcttccagcaggtggttaagctgaaaggccaagtcctgtcggtcatg
tatcgatttcgcaccaagaaccgggagtggatgttgatccgcaccagcagcttcacattc
cagaatccctattctgatgagattgagtacatcatctgcaccaacaccaacgtcaagcaa
cttcagcaacagcaggcagaattggaagtgcaccagagagatggattgtcatcgtatgac
ttatcccaggtccccgtccccaacctaccagccggtgttcatgaggccgggaagtccgtg
gaaaaggcggatgcaatcttctcccaggaaagagatcctcggtttgctgaaatgtttgca
ggaattagtgcatcggagaagaagatgatgagctcagcctctgcagcaggaacccagcag
atctactcccaaggaagcccatttccctctggacactccgggaaggccttcagctcttca
gtggttcatgtgcctggagtgaatgatattcagtcctcttcttccacgggccagaacatg
tcccaaatctcccggcagctaaaccagagtcaggtggcatggacagggagtcgtccgccc
tttccgggacagcaaatcccatctcagtccagcaagactcagtcatctccctttgggatt
ggaacgagccacacctacccggcagacccctcttcctacagccccctctccagcccagct
acctcctcgccaagtgggaatgcctactccagtcttgccaacaggactccagggttcgct
gaaagtggacaaagtagcgggcagttccaagggcggccctcggaagtctggtcgcagtgg
caaagccagcaccatggccagcagagcggtgagcagcactcccaccagcagcccggtcag
actgaagtgttccaggacatgctgcccatgccaggagatccaacccaggggactggcaac
tataacatcgaagactttgccgacctgggcatgtttccaccgttttctgagtag

DBGET integrated database retrieval system