KEGG   Homo sapiens (human): 4050Help
Entry
4050              CDS       T01001                                 

Gene name
LTB, TNFC, TNFSF3, TNLG1C, p33
Definition
(RefSeq) lymphotoxin beta
  KO
K03157  lymphotoxin beta (TNF superfamily, member 3)
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04064  NF-kappa B signaling pathway
hsa05323  Rheumatoid arthritis
Drug target
Baminercept: D08866
Lenercept: D04690
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    4050 (LTB)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    4050 (LTB)
 Human Diseases
  Immune diseases
   05323 Rheumatoid arthritis
    4050 (LTB)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  Tumor necrosis fators
   4050 (LTB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNF
Motif
Other DBs
NCBI-GeneID: 4050
NCBI-ProteinID: NP_002332
OMIM: 600978
HGNC: 6711
Ensembl: ENSG00000227507
Vega: OTTHUMG00000031136
Pharos: Q06643(Tbio)
UniProt: Q06643 Q5STB2
Structure
PDB: 

Position
6p21.33
AA seq 244 aa AA seqDB search
MGALGLEGRGGRLQGRGSLLLAVAGATSLVTLLLAVPITVLAVLALVPQDQGGLVTETAD
PGAQAQQGLGFQKLPEEEPETDLSPGLPAAHLIGAPLKGQGLGWETTKEQAFLTSGTQFS
DAEGLALPQDGLYYLYCLVGYRGRAPPGGGDPQGRSVTLRSSLYRAGGAYGPGTPELLLE
GAETVTPVLDPARRQGYGPLWYTSVGFGGLVQLRRGERVYVNISHPDMVDFARGKTFFGA
VMVG
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgggggcactggggctggagggcaggggtgggaggctccaggggaggggttccctcctg
ctagctgtggcaggagccacttctctggtgaccttgttgctggcggtgcctatcactgtc
ctggctgtgctggccttagtgccccaggatcagggaggactggtaacggagacggccgac
cccggggcacaggcccagcaaggactggggtttcagaagctgccagaggaggagccagaa
acagatctcagccccgggctcccagctgcccacctcataggcgctccgctgaaggggcag
gggctaggctgggagacgacgaaggaacaggcgtttctgacgagcgggacgcagttctcg
gacgccgaggggctggcgctcccgcaggacggcctctattacctctactgtctcgtcggc
taccggggccgggcgccccctggcggcggggacccccagggccgctcggtcacgctgcgc
agctctctgtaccgggcggggggcgcctacgggccgggcactcccgagctgctgctcgag
ggcgccgagacggtgactccagtgctggacccggccaggagacaagggtacgggcctctc
tggtacacgagcgtggggttcggcggcctggtgcagctccggaggggcgagagggtgtac
gtcaacatcagtcaccccgatatggtggacttcgcgagagggaagaccttctttggggcc
gtgatggtggggtga

DBGET integrated database retrieval system