KEGG   Homo sapiens (human): 4055Help
Entry
4055              CDS       T01001                                 

Gene name
LTBR, D12S370, LT-BETA-R, TNF-R-III, TNFCR, TNFR-RP, TNFR2-RP, TNFR3, TNFRSF3
Definition
(RefSeq) lymphotoxin beta receptor
  KO
K03159  lymphotoxin beta receptor TNFR superfamily member 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04064  NF-kappa B signaling pathway
hsa04066  HIF-1 signaling pathway
hsa04672  Intestinal immune network for IgA production
hsa05166  Human T-cell leukemia virus 1 infection
hsa05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    4055 (LTBR)
   04066 HIF-1 signaling pathway
    4055 (LTBR)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    4055 (LTBR)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    4055 (LTBR)
 09160 Human Diseases
  09161 Cancers: Overview
   05203 Viral carcinogenesis
    4055 (LTBR)
  09172 Infectious diseases: Viral
   05166 Human T-cell leukemia virus 1 infection
    4055 (LTBR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    4055 (LTBR)
Cytokine receptors [BR:hsa04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   4055 (LTBR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNFR_c6
Motif
Other DBs
NCBI-GeneID: 4055
NCBI-ProteinID: NP_002333
OMIM: 600979
HGNC: 6718
Ensembl: ENSG00000111321
Vega: OTTHUMG00000168356
Pharos: P36941(Tbio)
UniProt: P36941
Structure
PDB: 

Position
12p13.31
AA seq 435 aa AA seqDB search
MLLPWATSAPGLAWGPLVLGLFGLLAASQPQAVPPYASENQTCRDQEKEYYEPQHRICCS
RCPPGTYVSAKCSRIRDTVCATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKR
KTQCRCQPGMFCAAWALECTHCELLSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSS
PSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGTMLMLAVLLPLAFFLLL
ATVFSCIWKSHPSLCRKLGSLLKRRPQGEGPNPVAGSWEPPKAHPYFPDLVQPLLPISGD
VSPVSTGLPAAPVLEAGVPQQQSPLDLTREPQLEPGEQSQVAHGTNGIHVTGGSMTITGN
IYIYNGPVLGGPPGPGDLPATPEPPYPIPEEGDPGPPGLSTPHQEDGKAWHLAETEHCGA
TPSNRGPRNQFITHD
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgctcctgccttgggccacctctgcccccggcctggcctgggggcctctggtgctgggc
ctcttcgggctcctggcagcatcgcagccccaggcggtgcctccatatgcgtcggagaac
cagacctgcagggaccaggaaaaggaatactatgagccccagcaccgcatctgctgctcc
cgctgcccgccaggcacctatgtctcagctaaatgtagccgcatccgggacacagtttgt
gccacatgtgccgagaattcctacaacgagcactggaactacctgaccatctgccagctg
tgccgcccctgtgacccagtgatgggcctcgaggagattgccccctgcacaagcaaacgg
aagacccagtgccgctgccagccgggaatgttctgtgctgcctgggccctcgagtgtaca
cactgcgagctactttctgactgcccgcctggcactgaagccgagctcaaagatgaagtt
gggaagggtaacaaccactgcgtcccctgcaaggccgggcacttccagaatacctcctcc
cccagcgcccgctgccagccccacaccaggtgtgagaaccaaggtctggtggaggcagct
ccaggcactgcccagtccgacacaacctgcaaaaatccattagagccactgcccccagag
atgtcaggaaccatgctgatgctggccgttctgctgccactggccttctttctgctcctt
gccaccgtcttctcctgcatctggaagagccacccttctctctgcaggaaactgggatcg
ctgctcaagaggcgtccgcagggagagggacccaatcctgtagctggaagctgggagcct
ccgaaggcccatccatacttccctgacttggtacagccactgctacccatttctggagat
gtttccccagtatccactgggctccccgcagccccagttttggaggcaggggtgccgcaa
cagcagagtcctctggacctgaccagggagccgcagttggaacccggggagcagagccag
gtggcccacggtaccaatggcattcatgtcaccggcgggtctatgactatcactggcaac
atctacatctacaatggaccagtactggggggaccaccgggtcctggagacctcccagct
acccccgaacctccataccccattcccgaagagggggaccctggccctcccgggctctct
acaccccaccaggaagatggcaaggcttggcacctagcggagacagagcactgtggtgcc
acaccctctaacaggggcccaaggaaccaatttatcacccatgactga

DBGET integrated database retrieval system