KEGG   Homo sapiens (human): 4056
Entry
4056              CDS       T01001                                 

Gene name
LTC4S
Definition
(RefSeq) leukotriene C4 synthase
  KO
K00807  leukotriene-C4 synthase [EC:4.4.1.20]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00590  Arachidonic acid metabolism
hsa01100  Metabolic pathways
Disease
H02284  Leukotriene C4 synthase deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    4056 (LTC4S)
Enzymes [BR:hsa01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.20  leukotriene-C4 synthase
     4056 (LTC4S)
SSDB
Motif
Pfam: MAPEG
Other DBs
NCBI-GeneID: 4056
NCBI-ProteinID: NP_665874
OMIM: 246530
HGNC: 6719
Ensembl: ENSG00000213316
Vega: OTTHUMG00000150314
Pharos: Q16873(Tbio)
UniProt: Q16873
Structure
PDB: 

Position
5q35.3
AA seq 150 aa
MKDEVALLAAVTLLGVLLQAYFSLQVISARRAFRVSPPLTTGPPEFERVYRAQVNCSEYF
PLFLATLWVAGIFFHEGAAALCGLVYLFARLRYFQGYARSAQLRLAPLYASARALWLLVA
LAALGLLAHFLPAALRAALLGRLRTLLPWA
NT seq 453 nt   +upstreamnt  +downstreamnt
atgaaggacgaggtagctctactggctgctgtcaccctcctgggagtcctgctgcaagcc
tacttctccctgcaggtgatctcggcgcgcagggccttccgcgtgtcgccgccgctcacc
accggcccacccgagttcgagcgcgtctaccgagcccaggtgaactgcagcgagtacttc
ccgctgttcctcgccacgctctgggtcgccggcatcttctttcatgaaggggcggcggcc
ctgtgcggcctggtctacctgttcgcgcgcctccgctacttccagggctacgcgcgctcc
gcgcagctcaggctggcaccgctgtacgcgagcgcgcgcgccctctggctgctggtggcg
ctggctgcgctcggcctgctcgcccacttcctcccggccgcgctgcgcgccgcgctcctc
ggacggctccggacgctgctgccgtgggcctga

DBGET integrated database retrieval system