KEGG   Homo sapiens (human): 4057Help
Entry
4057              CDS       T01001                                 

Gene name
LTF, GIG12, HEL110, HLF2, LF
Definition
(RefSeq) lactotransferrin
  KO
K17283  lactotransferrin [EC:3.4.21.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    4057 (LTF)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     4057 (LTF)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   4057 (LTF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transferrin Phosphonate-bd Abhydrolase_4
Motif
Other DBs
NCBI-GeneID: 4057
NCBI-ProteinID: NP_002334
OMIM: 150210
HGNC: 6720
Ensembl: ENSG00000012223
Vega: OTTHUMG00000156325
Pharos: P02788(Tbio)
UniProt: P02788 V9HWI4
Structure
PDB: 

Position
3p21.31
AA seq 710 aa AA seqDB search
MKLVFLVLLFLGALGLCLAGRRRSVQWCAVSQPEATKCFQWQRNMRKVRGPPVSCIKRDS
PIQCIQAIAENRADAVTLDGGFIYEAGLAPYKLRPVAAEVYGTERQPRTHYYAVAVVKKG
GSFQLNELQGLKSCHTGLRRTAGWNVPIGTLRPFLNWTGPPEPIEAAVARFFSASCVPGA
DKGQFPNLCRLCAGTGENKCAFSSQEPYFSYSGAFKCLRDGAGDVAFIRESTVFEDLSDE
AERDEYELLCPDNTRKPVDKFKDCHLARVPSHAVVARSVNGKEDAIWNLLRQAQEKFGKD
KSPKFQLFGSPSGQKDLLFKDSAIGFSRVPPRIDSGLYLGSGYFTAIQNLRKSEEEVAAR
RARVVWCAVGEQELRKCNQWSGLSEGSVTCSSASTTEDCIALVLKGEADAMSLDGGYVYT
AGKCGLVPVLAENYKSQQSSDPDPNCVDRPVEGYLAVAVVRRSDTSLTWNSVKGKKSCHT
AVDRTAGWNIPMGLLFNQTGSCKFDEYFSQSCAPGSDPRSNLCALCIGDEQGENKCVPNS
NERYYGYTGAFRCLAENAGDVAFVKDVTVLQNTDGNNNEAWAKDLKLADFALLCLDGKRK
PVTEARSCHLAMAPNHAVVSRMDKVERLKQVLLHQQAKFGRNGSDCPDKFCLFQSETKNL
LFNDNTECLARLHGKTTYEKYLGPQYVAGITNLKKCSTSPLLEACEFLRK
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttgtcttcctcgtcctgctgttcctcggggccctcggactgtgtctggctggc
cgtaggaggagtgttcagtggtgcgccgtatcccaacccgaggccacaaaatgcttccaa
tggcaaaggaatatgagaaaagtgcgtggccctcctgtcagctgcataaagagagactcc
cccatccagtgtatccaggccattgcggaaaacagggccgatgctgtgacccttgatggt
ggtttcatatacgaggcaggcctggccccctacaaactgcgacctgtagcggcggaagtc
tacgggaccgaaagacagccacgaactcactattatgccgtggctgtggtgaagaagggc
ggcagctttcagctgaacgaactgcaaggtctgaagtcctgccacacaggccttcgcagg
accgctggatggaatgtccctatagggacacttcgtccattcttgaattggacgggtcca
cctgagcccattgaggcagctgtggccaggttcttctcagccagctgtgttcccggtgca
gataaaggacagttccccaacctgtgtcgcctgtgtgcggggacaggggaaaacaaatgt
gccttctcctcccaggaaccgtacttcagctactctggtgccttcaagtgtctgagagac
ggggctggagacgtggcttttatcagagagagcacagtgtttgaggacctgtcagacgag
gctgaaagggacgagtatgagttactctgcccagacaacactcggaagccagtggacaag
ttcaaagactgccatctggcccgggtcccttctcatgccgttgtggcacgaagtgtgaat
ggcaaggaggatgccatctggaatcttctccgccaggcacaggaaaagtttggaaaggac
aagtcaccgaaattccagctctttggctcccctagtgggcagaaagatctgctgttcaag
gactctgccattgggttttcgagggtgcccccgaggatagattctgggctgtaccttggc
tccggctacttcactgccatccagaacttgaggaaaagtgaggaggaagtggctgcccgg
cgtgcgcgggtcgtgtggtgtgcggtgggcgagcaggagctgcgcaagtgtaaccagtgg
agtggcttgagcgaaggcagcgtgacctgctcctcggcctccaccacagaggactgcatc
gccctggtgctgaaaggagaagctgatgccatgagtttggatggaggatatgtgtacact
gcaggcaaatgtggtttggtgcctgtcctggcagagaactacaaatcccaacaaagcagt
gaccctgatcctaactgtgtggatagacctgtggaaggatatcttgctgtggcggtggtt
aggagatcagacactagccttacctggaactctgtgaaaggcaagaagtcctgccacacc
gccgtggacaggactgcaggctggaatatccccatgggcctgctcttcaaccagacgggc
tcctgcaaatttgatgaatatttcagtcaaagctgtgcccctgggtctgacccgagatct
aatctctgtgctctgtgtattggcgacgagcagggtgagaataagtgcgtgcccaacagc
aacgagagatactacggctacactggggctttccggtgcctggctgagaatgctggagac
gttgcatttgtgaaagatgtcactgtcttgcagaacactgatggaaataacaatgaggca
tgggctaaggatttgaagctggcagactttgcgctgctgtgcctcgatggcaaacggaag
cctgtgactgaggctagaagctgccatcttgccatggccccgaatcatgccgtggtgtct
cggatggataaggtggaacgcctgaaacaggtgttgctccaccaacaggctaaatttggg
agaaatggatctgactgcccggacaagttttgcttattccagtctgaaaccaaaaacctt
ctgttcaatgacaacactgagtgtctggccagactccatggcaaaacaacatatgaaaaa
tatttgggaccacagtatgtcgcaggcattactaatctgaaaaagtgctcaacctccccc
ctcctggaagcctgtgaattcctcaggaagtaa

DBGET integrated database retrieval system