KEGG   Homo sapiens (human): 4059Help
Entry
4059              CDS       T01001                                 

Gene name
BCAM, AU, CD239, LU, MSK19
Definition
(RefSeq) basal cell adhesion molecule (Lutheran blood group)
  KO
K06578  Lutheran blood group glycoprotein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    4059 (BCAM)
CD molecules [BR:hsa04090]
 Proteins
  4059 (BCAM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_3 C2-set_2 Ig_2 I-set ig V-set Izumo-Ig SKG6
Motif
Other DBs
NCBI-GeneID: 4059
NCBI-ProteinID: NP_005572
OMIM: 612773
HGNC: 6722
Ensembl: ENSG00000187244
Vega: OTTHUMG00000180838
Pharos: P50895(Tbio)
UniProt: P50895
Structure
PDB: 

Position
19q13.32
AA seq 628 aa AA seqDB search
MEPPDAPAQARGAPRLLLLAVLLAAHPDAQAEVRLSVPPLVEVMRGKSVILDCTPTGTHD
HYMLEWFLTDRSGARPRLASAEMQGSELQVTMHDTRGRSPPYQLDSQGRLVLAEAQVGDE
RDYVCVVRAGAAGTAEATARLNVFAKPEATEVSPNKGTLSVMEDSAQEIATCNSRNGNPA
PKITWYRNGQRLEVPVEMNPEGYMTSRTVREASGLLSLTSTLYLRLRKDDRDASFHCAAH
YSLPEGRHGRLDSPTFHLTLHYPTEHVQFWVGSPSTPAGWVREGDTVQLLCRGDGSPSPE
YTLFRLQDEQEEVLNVNLEGNLTLEGVTRGQSGTYGCRVEDYDAADDVQLSKTLELRVAY
LDPLELSEGKVLSLPLNSSAVVNCSVHGLPTPALRWTKDSTPLGDGPMLSLSSITFDSNG
TYVCEASLPTVPVLSRTQNFTLLVQGSPELKTAEIEPKADGSWREGDEVTLICSARGHPD
PKLSWSQLGGSPAEPIPGRQGWVSSSLTLKVTSALSRDGISCEASNPHGNKRHVFHFGTV
SPQTSQAGVAVMAVAVSVGLLLLVVAVFYCVRRKGGPCCRQRREKGAPPPGEPGLSHSGS
EQPEQTGLLMGGASGGARGGSGGFGDEC
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atggagcccccggacgcaccggcccaggcgcgcggggccccgcggctgctgttgctcgca
gtcctgctggcggcgcacccagatgcccaggcggaggtgcgcttgtctgtacccccgctg
gtggaggtgatgcgaggaaagtctgtcattctggactgcacccctacgggaacccacgac
cattatatgctggaatggttccttaccgaccgctcgggagctcgcccccgcctagcctcg
gctgagatgcagggctctgagctccaggtcacaatgcacgacacccggggccgcagtccc
ccataccagctggactcccaggggcgcctggtgctggctgaggcccaggtgggcgacgag
cgagactacgtgtgcgtggtgagggcaggggcggcaggcactgctgaggccactgcgcgg
ctcaacgtgtttgcaaagccagaggccactgaggtctcccccaacaaagggacactgtct
gtgatggaggactctgcccaggagatcgccacctgcaacagccggaacgggaacccggcc
cccaagatcacgtggtatcgcaacgggcagcgcctggaggtgcccgtagagatgaaccca
gagggctacatgaccagccgcacggtccgggaggcctcgggcctgctctccctcaccagc
accctctacctgcggctccgcaaggatgaccgagacgccagcttccactgcgccgcccac
tacagcctgcccgagggccgccacggccgcctggacagccccaccttccacctcaccctg
cactatcccacggagcacgtgcagttctgggtgggcagcccgtccaccccagcaggctgg
gtacgcgagggtgacactgtccagctgctctgccggggggacggcagccccagcccggag
tatacgcttttccgccttcaggatgagcaggaggaagtgctgaatgtgaatctcgagggg
aacttgaccctggagggagtgacccggggccagagcgggacctatggctgcagagtggag
gattacgacgcggcagatgacgtgcagctctccaagacgctggagctgcgcgtggcctat
ctggaccccctggagctcagcgaggggaaggtgctttccttacctctaaacagcagtgca
gtcgtgaactgctccgtgcacggcctgcccacccctgccctacgctggaccaaggactcc
actcccctgggcgatggccccatgctgtcgctcagttctatcaccttcgattccaatggc
acctacgtatgtgaggcctccctgcccacagtcccggtcctcagccgcacccagaacttc
acgctgctggtccaaggctcgccagagctaaagacagcggaaatagagcccaaggcagat
ggcagctggagggaaggagacgaagtcacactcatctgctctgcccgcggccatccagac
cccaaactcagctggagccaattggggggcagccccgcagagccaatccccggacggcag
ggttgggtgagcagctctctgaccctgaaagtgaccagcgccctgagccgcgatggcatc
tcctgtgaagcctccaacccccacgggaacaagcgccatgtcttccacttcggcaccgtg
agcccccagacctcccaggctggagtggccgtcatggccgtggccgtcagcgtgggcctc
ctgctcctcgtcgttgctgtcttctactgcgtgagacgcaaagggggcccctgctgccgc
cagcggcgggagaagggggctccgccgccaggggagccagggctgagccactcggggtcg
gagcaaccagagcagaccggccttctcatgggaggtgcctccggaggagccaggggtggc
agcgggggcttcggagacgagtgctga

DBGET integrated database retrieval system