KEGG   Homo sapiens (human): 406Help
Entry
406               CDS       T01001                                 

Gene name
ARNTL, BMAL1, BMAL1c, JAP3, MOP3, PASD3, TIC, bHLHe5
Definition
(RefSeq) aryl hydrocarbon receptor nuclear translocator like
  KO
K02296  aryl hydrocarbon receptor nuclear translocator-like protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04710  Circadian rhythm
hsa04728  Dopaminergic synapse
hsa05168  Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    406 (ARNTL)
  09159 Environmental adaptation
   04710 Circadian rhythm
    406 (ARNTL)
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05168 Herpes simplex infection
    406 (ARNTL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    406 (ARNTL)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    406 (ARNTL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAS_11 PAS PAS_3 HLH PAS_9 PAS_4 PAS_2
Motif
Other DBs
NCBI-GeneID: 406
NCBI-ProteinID: NP_001284648
OMIM: 602550
HGNC: 701
Ensembl: ENSG00000133794
Vega: OTTHUMG00000150623
Pharos: O00327(Tbio)
UniProt: O00327 B2RCL8
Structure
PDB: 

Position
11p15.3
AA seq 626 aa AA seqDB search
MADQRMDISSTISDFMSPGPTDLLSSSLGTSGVDCNRKRKGSSTDYQESMDTDKDDPHGR
LEYTEHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQ
HMKTLRGATNPYTEANYKPTFLSDDELKHLILRAADGFLFVVGCDRGKILFVSESVFKIL
NYSQNDLIGQSLFDYLHPKDIAKVKEQLSSSDTAPRERLIDAKTGLPVKTDITPGPSRLC
SGARRSFFCRMKCNRPSVKVEDKDFPSTCSKKKADRKSFCTIHSTGYLKSWPPTKMGLDE
DNEPDNEGCNLSCLVAIGRLHSHVVPQPVNGEIRVKSMEYVSRHAIDGKFVFVDQRATAI
LAYLPQELLGTSCYEYFHQDDIGHLAECHRQVLQTREKITTNCYKFKIKDGSFITLRSRW
FSFMNPWTKEVEYIVSTNTVVLANVLEGGDPTFPQLTASPHSMDSMLPSGEGGPKRTHPT
VPGIPGGTRAGAGKIGRMIAEEIMEIHRIRGSSPSSCGSSPLNITSTPPPDASSPGGKKI
LNGGTPDIPSSGLLSGQAQENPGYPYSDSSSILGENPHIGIDMIDNDQGSSSPSNDEAAM
AVIMSLLEADAGLGGPVDFSDLPWPL
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atggcagaccagagaatggacatttcttcaaccatcagtgatttcatgtccccgggcccc
accgacctgctttccagctctcttggtaccagtggtgtggattgcaaccgcaaacggaaa
ggcagctccactgactaccaagaaagcatggacacagacaaagatgaccctcatggaagg
ttagaatatacagaacaccaaggaaggataaaaaatgcaagggaagctcacagtcagatt
gaaaagcggcgtcgggataaaatgaacagttttatagatgaattggcttctttggtacca
acatgcaacgcaatgtccaggaaattagataaacttactgtgctaaggatggctgttcag
cacatgaaaacattaagaggtgccaccaatccatacacagaagcaaactacaaaccaact
tttctatcagacgatgaattgaaacacctcattctcagggcagcagatggatttttgttt
gtcgtaggatgtgaccgagggaagatactctttgtctcagagtctgtcttcaagatcctc
aactacagccagaatgatctgattggtcagagtttgtttgactacctgcatcctaaagat
attgccaaagtcaaggagcagctctcctcctctgacaccgcaccccgggagcggctcata
gatgcaaaaactggacttccagttaaaacagatataacccctgggccatctcgattatgt
tctggagcacgacgttctttcttctgtaggatgaagtgtaacaggccttcagtaaaggtt
gaagacaaggacttcccctctacctgctcaaagaaaaaagcagatcgaaaaagcttctgc
acaatccacagcacaggctatttgaaaagctggccacccacaaagatggggctggatgaa
gacaacgaaccagacaatgaggggtgtaacctcagctgcctcgtcgcaattggacgactg
cattctcatgtagttccacaaccagtgaacggggaaatcagggtgaaatctatggaatat
gtttctcggcacgcgatagatggaaagtttgtttttgtagaccagagggcaacagctatt
ttggcatatttaccacaagaacttctaggcacatcgtgttatgaatattttcaccaagat
gacataggacatcttgcagaatgtcataggcaagttttacagacgagagaaaaaattaca
actaattgctataaatttaaaatcaaagatggttcttttatcacactacggagtcgatgg
ttcagtttcatgaacccttggaccaaggaagtagaatatattgtctcaactaacactgtt
gttttagccaacgtcctggaaggcggggacccaaccttcccacagctcacagcatccccc
cacagcatggacagcatgctgccctctggagaaggtggcccaaagaggacccaccccact
gttccagggattccagggggaacccgggctggggcaggaaaaataggccgaatgattgct
gaggaaatcatggaaatccacaggataagagggtcatcgccttctagctgtggctccagc
ccattgaacatcacgagtacgcctccccctgatgcctcttctccaggaggcaagaagatt
ttaaatggagggactccagacattccttccagtggcctactatcaggccaggctcaggag
aacccaggttatccatattctgatagttcttctattcttggtgagaacccccacataggt
atagacatgattgacaacgaccaaggatcaagtagtcccagtaatgatgaggcagcaatg
gctgtcatcatgagcctcttggaagcagatgctggactgggtggccctgttgactttagt
gacttgccatggccgctgtaa

DBGET integrated database retrieval system