KEGG   Homo sapiens (human): 406Help
Entry
406               CDS       T01001                                 

Gene name
ARNTL, BMAL1, BMAL1c, JAP3, MOP3, PASD3, TIC, bHLHe5
Definition
(RefSeq) aryl hydrocarbon receptor nuclear translocator like
  KO
K02296  aryl hydrocarbon receptor nuclear translocator-like protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04710  Circadian rhythm
hsa04728  Dopaminergic synapse
hsa05168  Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    406 (ARNTL)
  09159 Environmental adaptation
   04710 Circadian rhythm
    406 (ARNTL)
 09160 Human Diseases
  09167 Infectious diseases
   05168 Herpes simplex infection
    406 (ARNTL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    406 (ARNTL)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    406 (ARNTL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PAS_11 PAS PAS_3 HLH PAS_9 PAS_4 PAS_2
Motif
Other DBs
NCBI-GeneID: 406
NCBI-ProteinID: NP_001284648
OMIM: 602550
HGNC: 701
Ensembl: ENSG00000133794
Vega: OTTHUMG00000150623
Pharos: O00327(Tbio)
UniProt: O00327 B2RCL8
Structure
PDB: 

Position
11p15.3
AA seq 626 aa AA seqDB search
MADQRMDISSTISDFMSPGPTDLLSSSLGTSGVDCNRKRKGSSTDYQESMDTDKDDPHGR
LEYTEHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQ
HMKTLRGATNPYTEANYKPTFLSDDELKHLILRAADGFLFVVGCDRGKILFVSESVFKIL
NYSQNDLIGQSLFDYLHPKDIAKVKEQLSSSDTAPRERLIDAKTGLPVKTDITPGPSRLC
SGARRSFFCRMKCNRPSVKVEDKDFPSTCSKKKADRKSFCTIHSTGYLKSWPPTKMGLDE
DNEPDNEGCNLSCLVAIGRLHSHVVPQPVNGEIRVKSMEYVSRHAIDGKFVFVDQRATAI
LAYLPQELLGTSCYEYFHQDDIGHLAECHRQVLQTREKITTNCYKFKIKDGSFITLRSRW
FSFMNPWTKEVEYIVSTNTVVLANVLEGGDPTFPQLTASPHSMDSMLPSGEGGPKRTHPT
VPGIPGGTRAGAGKIGRMIAEEIMEIHRIRGSSPSSCGSSPLNITSTPPPDASSPGGKKI
LNGGTPDIPSSGLLSGQAQENPGYPYSDSSSILGENPHIGIDMIDNDQGSSSPSNDEAAM
AVIMSLLEADAGLGGPVDFSDLPWPL
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atggcagaccagagaatggacatttcttcaaccatcagtgatttcatgtccccgggcccc
accgacctgctttccagctctcttggtaccagtggtgtggattgcaaccgcaaacggaaa
ggcagctccactgactaccaagaaagcatggacacagacaaagatgaccctcatggaagg
ttagaatatacagaacaccaaggaaggataaaaaatgcaagggaagctcacagtcagatt
gaaaagcggcgtcgggataaaatgaacagttttatagatgaattggcttctttggtacca
acatgcaacgcaatgtccaggaaattagataaacttactgtgctaaggatggctgttcag
cacatgaaaacattaagaggtgccaccaatccatacacagaagcaaactacaaaccaact
tttctatcagacgatgaattgaaacacctcattctcagggcagcagatggatttttgttt
gtcgtaggatgtgaccgagggaagatactctttgtctcagagtctgtcttcaagatcctc
aactacagccagaatgatctgattggtcagagtttgtttgactacctgcatcctaaagat
attgccaaagtcaaggagcagctctcctcctctgacaccgcaccccgggagcggctcata
gatgcaaaaactggacttccagttaaaacagatataacccctgggccatctcgattatgt
tctggagcacgacgttctttcttctgtaggatgaagtgtaacaggccttcagtaaaggtt
gaagacaaggacttcccctctacctgctcaaagaaaaaagcagatcgaaaaagcttctgc
acaatccacagcacaggctatttgaaaagctggccacccacaaagatggggctggatgaa
gacaacgaaccagacaatgaggggtgtaacctcagctgcctcgtcgcaattggacgactg
cattctcatgtagttccacaaccagtgaacggggaaatcagggtgaaatctatggaatat
gtttctcggcacgcgatagatggaaagtttgtttttgtagaccagagggcaacagctatt
ttggcatatttaccacaagaacttctaggcacatcgtgttatgaatattttcaccaagat
gacataggacatcttgcagaatgtcataggcaagttttacagacgagagaaaaaattaca
actaattgctataaatttaaaatcaaagatggttcttttatcacactacggagtcgatgg
ttcagtttcatgaacccttggaccaaggaagtagaatatattgtctcaactaacactgtt
gttttagccaacgtcctggaaggcggggacccaaccttcccacagctcacagcatccccc
cacagcatggacagcatgctgccctctggagaaggtggcccaaagaggacccaccccact
gttccagggattccagggggaacccgggctggggcaggaaaaataggccgaatgattgct
gaggaaatcatggaaatccacaggataagagggtcatcgccttctagctgtggctccagc
ccattgaacatcacgagtacgcctccccctgatgcctcttctccaggaggcaagaagatt
ttaaatggagggactccagacattccttccagtggcctactatcaggccaggctcaggag
aacccaggttatccatattctgatagttcttctattcttggtgagaacccccacataggt
atagacatgattgacaacgaccaaggatcaagtagtcccagtaatgatgaggcagcaatg
gctgtcatcatgagcctcttggaagcagatgctggactgggtggccctgttgactttagt
gacttgccatggccgctgtaa

DBGET integrated database retrieval system