KEGG   Homo sapiens (human): 4061
Entry
4061              CDS       T01001                                 

Symbol
LY6E, RIG-E, RIGE, SCA-2, SCA2, TSA-1
Name
(RefSeq) lymphocyte antigen 6 family member E
  KO
K06846  lymphocyte antigen 6 complex locus protein D/E/F/G6/H
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    4061 (LY6E)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Antigens
  4061 (LY6E)
SSDB
Motif
Pfam: UPAR_LY6 Toxin_TOLIP UPAR_LY6_2
Other DBs
NCBI-GeneID: 4061
NCBI-ProteinID: NP_001120685
OMIM: 601384
HGNC: 6727
Ensembl: ENSG00000160932
Vega: OTTHUMG00000164754
Pharos: Q16553(Tbio)
UniProt: Q16553
Position
8:143018529..143022409
AA seq 131 aa
MKIFLPVLLAALLGVERASSLMCFSCLNQKSNLYCLKPTICSDQDNYCVTVSASAGIGNL
VTFGHSLSKTCSPACPIPEGVNVGVASMGISCCQSFLCNFSAADGGLRASVTLLGAGLLL
SLLPALLRFGP
NT seq 396 nt   +upstreamnt  +downstreamnt
atgaagatcttcttgccagtgctgctggctgcccttctgggtgtggagcgagccagctcg
ctgatgtgcttctcctgcttgaaccagaagagcaatctgtactgcctgaagccgaccatc
tgctccgaccaggacaactactgcgtgactgtgtctgctagtgccggcattgggaatctc
gtgacatttggccacagcctgagcaagacctgttccccggcctgccccatcccagaaggc
gtcaatgttggtgtggcttccatgggcatcagctgctgccagagctttctgtgcaatttc
agtgcggccgatggcgggctgcgggcaagcgtcaccctgctgggtgccgggctgctgctg
agcctgctgccggccctgctgcggtttggcccctga

DBGET integrated database retrieval system