KEGG   Homo sapiens (human): 4066Help
Entry
4066              CDS       T01001                                 

Gene name
LYL1, bHLHa18
Definition
(RefSeq) LYL1, basic helix-loop-helix family member
  KO
K15604  protein lyl-1
Organism
hsa  Homo sapiens (human)
Pathway
hsa05202  Transcriptional misregulation in cancer
Network
N00121  LMO2-rearrangement to transcriptional activation
N00122  LMO2-rearrangement to transcriptional repression
Disease
H00002  T lymphoblastic leukemia/lymphoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancers: Overview
   05202 Transcriptional misregulation in cancer
    4066 (LYL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    4066 (LYL1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Tal/Twist/Atonal/Hen, Lymphoid factors
    4066 (LYL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HLH
Motif
Other DBs
NCBI-GeneID: 4066
NCBI-ProteinID: NP_005574
OMIM: 151440
HGNC: 6734
Ensembl: ENSG00000104903
Vega: OTTHUMG00000180736
Pharos: P12980(Tbio)
UniProt: P12980
Position
19p13.13
AA seq 280 aa AA seqDB search
MCPPQAQAEVGPTMTEKAEMVCAPSPAPAPPPKPASPGPPQVEEVGHRGGSSPPRLPPGV
PVISLGHSRPPGVAMPTTELGTLRPPLLQLSTLGTAPPTLALHYHPHPFLNSVYIGPAGP
FSIFPSSRLKRRPSHCELDLAEGHQPQKVARRVFTNSRERWRQQNVNGAFAELRKLLPTH
PPDRKLSKNEVLRLAMKYIGFLVRLLRDQAAALAAGPTPPGPRKRPVHRVPDDGARRGSG
RRAEAAARSQPAPPADPDGSPGGAARPIKMEQTALSPEVR
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgtgcccgcctcaggcacaggcagaggtgggccccaccatgactgagaaggcagagatg
gtgtgtgcccccagcccagcgcctgccccaccccctaagcctgcctcgcctgggcccccg
caggtggaggaggtgggccaccgaggaggctcctcgccccccaggctgccacctggtgta
ccagtgatcagcctgggccacagcaggcccccaggggtagccatgcccaccacagagctg
ggcactctgcggcccccgctgctgcaactctccaccctgggaactgccccgcccactttg
gccctgcactaccaccctcaccccttcctcaacagtgtctacattgggccagcaggacct
tttagcatcttccctagcagccggttgaagcggagaccaagccactgtgagctggacctg
gctgaggggcaccagccccagaaggtggcccggcgcgtgttcaccaacagccgggagcgc
tggcggcagcagaacgttaacggcgccttcgccgagctgaggaagctgctgccgacgcac
ccgcccgaccggaagctgagcaagaacgaggtgctccgcctagccatgaagtacatcggc
ttcctggtgcggctgctgcgcgaccaagccgcagctctggccgcaggccccacccctccc
gggcctcgcaaacggccggtgcaccgggtcccagacgacggcgcccgccggggatccgga
cgcagggccgaggcggcagcgcgctcgcagcccgcgcccccggccgaccccgacggcagc
cccggtggagcggcccggcccatcaagatggagcaaaccgctttgagcccagaggtgcgg
tga

DBGET integrated database retrieval system