KEGG   Homo sapiens (human): 4072Help
Entry
4072              CDS       T01001                                 

Gene name
EPCAM, DIAR5, EGP-2, EGP314, EGP40, ESA, HNPCC8, KS1/4, KSA, M4S1, MIC18, MK-1, TACSTD1, TROP1
Definition
(RefSeq) epithelial cell adhesion molecule
  KO
K06737  epithelial cell adhesion molecule
Organism
hsa  Homo sapiens (human)
Disease
H00876  Mismatch repair deficiency
H01174  Congenital diarrhea
Drug target
Catumaxomab: D09207
Edrecolomab: D03958
Tucotuzumab celmoleukin: D09027
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    4072 (EPCAM)
   04090 CD molecules [BR:hsa04090]
    4072 (EPCAM)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   4072 (EPCAM)
  Exosomal proteins of colorectal cancer cells
   4072 (EPCAM)
CD molecules [BR:hsa04090]
 Proteins
  4072 (EPCAM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EpCAM_N Thyroglobulin_1 DAG1 Glycophorin_A Trp_oprn_chp Baculo_11_kDa
Motif
Other DBs
NCBI-GeneID: 4072
NCBI-ProteinID: NP_002345
OMIM: 185535
HGNC: 11529
Ensembl: ENSG00000119888
Vega: OTTHUMG00000128853
Pharos: P16422(Tbio)
UniProt: P16422
Structure
PDB: 

Position
2p21
AA seq 314 aa AA seqDB search
MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICS
KLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVN
TAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKF
ITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQL
DLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVVAGIVVLVISRKKRMAKYEKA
EIKEMGEMHRELNA
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccccgcaggtcctcgcgttcgggcttctgcttgccgcggcgacggcgactttt
gccgcagctcaggaagaatgtgtctgtgaaaactacaagctggccgtaaactgctttgtg
aataataatcgtcaatgccagtgtacttcagttggtgcacaaaatactgtcatttgctca
aagctggctgccaaatgtttggtgatgaaggcagaaatgaatggctcaaaacttgggaga
agagcaaaacctgaaggggccctccagaacaatgatgggctttatgatcctgactgcgat
gagagcgggctctttaaggccaagcagtgcaacggcacctccatgtgctggtgtgtgaac
actgctggggtcagaagaacagacaaggacactgaaataacctgctctgagcgagtgaga
acctactggatcatcattgaactaaaacacaaagcaagagaaaaaccttatgatagtaaa
agtttgcggactgcacttcagaaggagatcacaacgcgttatcaactggatccaaaattt
atcacgagtattttgtatgagaataatgttatcactattgatctggttcaaaattcttct
caaaaaactcagaatgatgtggacatagctgatgtggcttattattttgaaaaagatgtt
aaaggtgaatccttgtttcattctaagaaaatggacctgacagtaaatggggaacaactg
gatctggatcctggtcaaactttaatttattatgttgatgaaaaagcacctgaattctca
atgcagggtctaaaagctggtgttattgctgttattgtggttgtggtgatagcagttgtt
gctggaattgttgtgctggttatttccagaaagaagagaatggcaaagtatgagaaggct
gagataaaggagatgggtgagatgcatagggaactcaatgcataa

DBGET integrated database retrieval system