KEGG   Homo sapiens (human): 4076Help
Entry
4076              CDS       T01001                                 

Gene name
CAPRIN1, GPIAP1, GPIP137, GRIP137, M11S1, RNG105, p137GPI
Definition
(RefSeq) cell cycle associated protein 1
  KO
K18743  caprin-1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    4076 (CAPRIN1)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Other mRNA localization factors
     4076 (CAPRIN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Caprin-1_C Caprin-1_dimer DUF1140
Motif
Other DBs
NCBI-GeneID: 4076
NCBI-ProteinID: NP_005889
OMIM: 601178
HGNC: 6743
Ensembl: ENSG00000135387
Vega: OTTHUMG00000166248
Pharos: Q14444(Tbio)
UniProt: Q14444
Structure
PDB: 

Position
11p13
AA seq 709 aa AA seqDB search
MPSATSHSGSGSKSSGPPPPSGSSGSEAAAGAGAAAPASQHPATGTGAVQTEAMKQILGV
IDKKLRNLEKKKGKLDDYQERMNKGERLNQDQLDAVSKYQEVTNNLEFAKELQRSFMALS
QDIQKTIKKTARREQLMREEAEQKRLKTVLELQYVLDKLGDDEVRTDLKQGLNGVPILSE
EELSLLDEFYKLVDPERDMSLRLNEQYEHASIHLWDLLEGKEKPVCGTTYKVLKEIVERV
FQSNYFDSTHNHQNGLCEEEEAASAPAVEDQVPEAEPEPAEEYTEQSEVESTEYVNRQFM
AETQFTSGEKEQVDEWTVETVEVVNSLQQQPQAASPSVPEPHSLTPVAQADPLVRRQRVQ
DLMAQMQGPYNFIQDSMLDFENQTLDPAIVSAQPMNPTQNMDMPQLVCPPVHSESRLAQP
NQVPVQPEATQVPLVSSTSEGYTASQPLYQPSHATEQRPQKEPIDQIQATISLNTDQTTA
SSSLPAASQPQVFQAGTSKPLHSSGINVNAAPFQSMQTVFNMNAPVPPVNEPETLKQQNQ
YQASYNQSFSSQPHQVEQTELQQEQLQTVVGTYHGSPDQSHQVTGNHQQPPQQNTGFPRS
NQPYYNSRGVSRGGSRGARGLMNGYRGPANGFRGGYDGYRPSFSNTPNSGYTQSQFSAPR
DYSGYQRDGYQQNFKRGSGQSGPRGAPRGRGGPPRPNRGMPQMNTQQVN
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atgccctcggccaccagccacagcgggagcggcagcaagtcgtccggaccgccaccgccg
tcgggttcctccgggagtgaggcggccgcgggagccggggccgccgcgccggcttctcag
caccccgcaaccggcaccggcgctgtccagaccgaggccatgaagcagattctcggggtg
atcgacaagaaacttcggaacctggagaagaaaaagggtaagcttgatgattaccaggaa
cgaatgaacaaaggggaaaggcttaatcaagatcagctggatgccgtttctaagtaccag
gaagtcacaaataatttggagtttgcaaaagaattacagaggagtttcatggcactaagt
caagatattcagaaaacaataaagaagacagcacgtcgggagcagcttatgagagaagaa
gctgaacagaaacgtttaaaaactgtacttgagctacagtatgttttggacaaattggga
gatgatgaagtgcggactgacctgaaacaaggtttgaatggagtgccaatattgtccgaa
gaggagttgtcattgttggatgaattctataagctagtagaccctgaacgggacatgagc
ttgaggttgaatgaacagtatgaacatgcctccattcacctgtgggacctgctggaaggg
aaggaaaaacctgtatgtggaaccacctataaagttctaaaggaaattgttgagcgtgtt
tttcagtcaaactactttgacagcacccacaaccaccagaatgggctgtgtgaggaagaa
gaggcagcctcagcacctgcagttgaagaccaggtacctgaagctgaacctgagccagca
gaagagtacactgagcaaagtgaagttgaatcaacagagtatgtaaatagacagttcatg
gcagaaacacagttcaccagtggtgaaaaggagcaggtagatgagtggacagttgaaacg
gttgaggtggtaaattcactccagcagcaacctcaggctgcatccccttcagtaccagag
ccccactctttgactccagtggctcaggcagatccccttgtgagaagacagcgagtacaa
gaccttatggcacaaatgcagggtccctataatttcatacaggattcaatgctggatttt
gaaaatcagacacttgatcctgccattgtatctgcacagcctatgaatccaacacaaaac
atggacatgccccagctggtttgccctccagttcattctgaatctagacttgctcagcct
aatcaagttcctgtacaaccagaagcgacacaggttcctttggtatcatccacaagtgag
gggtacacagcatctcaacccttgtaccagccttctcatgctacagagcaacgaccacag
aaggaaccaattgatcagattcaggcaacaatctctttaaatacagaccagactacagca
tcatcatcccttcctgctgcgtctcagcctcaagtatttcaggctgggacaagcaaacct
ttacatagcagtggaatcaatgtaaatgcagctccattccaatccatgcaaacggtgttc
aatatgaatgccccagttcctcctgttaatgaaccagaaactttaaaacagcaaaatcag
taccaggccagttataaccagagcttttctagtcagcctcaccaagtagaacaaacagag
cttcagcaagaacagcttcaaacagtggttggcacttaccatggttccccagaccagtcc
catcaagtgactggtaaccaccagcagcctcctcagcagaacactggatttccacgtagc
aatcagccctattacaatagtcgtggtgtgtctcgtggaggctcccgtggtgctagaggc
ttgatgaatggataccggggccctgccaatggattcagaggaggatatgatggttaccgc
ccttcattctctaacactccaaacagtggttatacacagtctcagttcagtgctccccgg
gattactctggctatcaacgggatggatatcagcagaatttcaagcgaggctctgggcag
agtggaccacggggagccccacgaggtcgtggagggcccccaagacccaacagagggatg
ccgcaaatgaacactcagcaagtgaattaa

DBGET integrated database retrieval system