KEGG   Homo sapiens (human): 4081Help
Entry
4081              CDS       T01001                                 

Gene name
MAB21L1, CAGR1, Nbla00126
Definition
(RefSeq) mab-21 like 1
  KO
K23092  putative nucleotidyltransferase [EC:2.7.7.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    4081 (MAB21L1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.-  
     4081 (MAB21L1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mab-21
Motif
Other DBs
NCBI-GeneID: 4081
NCBI-ProteinID: NP_005575
OMIM: 601280
HGNC: 6757
Ensembl: ENSG00000180660
Vega: OTTHUMG00000016723
Pharos: Q13394(Tdark)
UniProt: Q13394 F1T0A2 B2R805
Structure
PDB: 

Position
13q13.3
AA seq 359 aa AA seqDB search
MIAAQAKLVYHLNKYYNEKCQARKAAIAKTIREVCKVVSDVLKEVEVQEPRFISSLNEMD
NRYEGLEVISPTEFEVVLYLNQMGVFNFVDDGSLPGCAVLKLSDGRKRSMSLWVEFITAS
GYLSARKIRSRFQTLVAQAVDKCSYRDVVKMVADTSEVKLRIRDRYVVQITPAFKCTGIW
PRSAAHWPLPHIPWPGPNRVAEVKAEGFNLLSKECHSLAGKQSSAESDAWVLQFAEAENR
LQMGGCRKKCLSILKTLRDRHLELPGQPLNNYHMKTLVSYECEKHPRESDWDESCLGDRL
NGILLQLISCLQCRRCPHYFLPNLDLFQGKPHSALENAAKQTWRLAREILTNPKSLEKL
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgattgcggcccaggccaagctggtctaccatctgaataaatactacaacgaaaaatgc
caagccaggaaagctgccattgccaaaactatccgggaagtctgcaaagtagtttccgac
gtactgaaggaagtggaagtgcaggagccgcggttcatcagctctctcaacgagatggac
aatcgctacgagggcctcgaggtcatctcccccaccgaatttgaagtggtgctttatctc
aaccaaatgggggtgttcaacttcgtggacgatggctcactgcccggctgcgcggtgctg
aagttgagcgacgggcgcaagaggagcatgtccctctgggtggaattcattaccgcctcc
ggctacctctcggcgcgcaaaatccggtccaggtttcagacgctggtggctcaagcggta
gacaaatgtagctaccgggatgtggtaaagatggtggcagacaccagcgaagtgaaactg
agaatccgagataggtacgtggtgcagatcacgccggcctttaaatgcaccgggatctgg
ccgaggagtgctgcccactggccacttccccacatcccctggccgggacccaaccgggtg
gcggaggtcaaggcggaaggtttcaatctcttgtccaaggagtgccactccttggccggc
aagcagagctcggcggagagcgacgcctgggtgctgcagttcgcggaggcagagaacaga
ctgcagatggggggctgcagaaagaagtgcctctccatcctcaaaaccttaagggatcgt
caccttgaactgccgggccagcccttgaacaattaccatatgaagactctggtttcctac
gagtgtgaaaagcatccccgagagtcggactgggacgagtcttgcctgggtgatcggctg
aacgggattttgctgcaacttatctcctgcctgcagtgccggcggtgtccccactacttt
ctaccgaacttagatctgtttcaaggcaaacctcactcagctctggaaaacgctgccaaa
caaacgtggcgactggcaagagagatcctgaccaacccgaaaagtttggaaaaactttag

DBGET integrated database retrieval system