KEGG   Homo sapiens (human): 4082
Entry
4082              CDS       T01001                                 

Gene name
MARCKS, 80K-L, MACS, PKCSL, PRKCSL
Definition
(RefSeq) myristoylated alanine rich protein kinase C substrate
  KO
K12561  myristoylated alanine-rich C-kinase substrate
Organism
hsa  Homo sapiens (human)
Pathway
hsa04666  Fc gamma R-mediated phagocytosis
hsa05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    4082 (MARCKS)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    4082 (MARCKS)
SSDB
Motif
Pfam: MARCKS
Other DBs
NCBI-GeneID: 4082
NCBI-ProteinID: NP_002347
OMIM: 177061
HGNC: 6759
Ensembl: ENSG00000277443
Vega: OTTHUMG00000188327
Pharos: P29966(Tbio)
UniProt: P29966 Q6NVI1
Position
6q21
AA seq 332 aa
MGAQFSKTAAKGEAAAERPGEAAVASSPSKANGQENGHVKVNGDASPAAAESGAKEELQA
NGSAPAADKEEPAAAGSGAASPSAAEKGEPAAAAAPEAGASPVEKEAPAEGEAAEPGSPT
AAEGEAASAASSTSSPKAEDGATPSPSNETPKKKKKRFSFKKSFKLSGFSFKKNKKEAGE
GGEAEAPAAEGGKDEAAGGAAAAAAEAGAASGEQAAAPGEEAAAGEEGAAGGDPQEAKPQ
EAAVAPEKPPASDETKAAEEPSKVEEKKAEEAGASAAACEAPSAAGPGAPPEQEAAPAEE
PAAAAASSACAAPSQEAQPECSPEAPPAEAAE
NT seq 999 nt   +upstreamnt  +downstreamnt
atgggtgcccagttctccaagaccgcagcgaagggagaagccgccgcggagaggcctggg
gaggcggctgtggcctcgtcgccttccaaagcgaacggacaggagaatggccacgtgaag
gtaaacggcgacgcttcgcccgcggccgccgagtcgggcgccaaggaggagctgcaggcc
aacggcagcgccccggccgccgacaaggaggagcccgcggccgccgggagcggggcggcg
tcgccctccgcggccgagaaaggtgagccggccgccgccgctgcccccgaggccggggcc
agcccggtagagaaggaggcccccgcggaaggcgaggctgccgagcccggctcgcccacg
gccgcggagggagaggccgcgtcggccgcctcctcgacttcttcgcccaaggccgaggac
ggggccacgccctcgcccagcaacgagaccccgaaaaaaaaaaagaagcgcttttccttc
aagaagtctttcaagctgagcggcttctccttcaagaagaacaagaaggaggctggagaa
ggcggtgaggctgaggcgcccgctgccgaaggcggcaaggacgaggccgccgggggcgca
gctgcggccgccgccgaggcgggcgcggcctccggggagcaggcagcggcgccgggcgag
gaggcggcagcgggcgaggagggggcggcgggtggcgacccgcaggaggccaagccccag
gaggccgctgtcgcgccagagaagccgcccgccagcgacgagaccaaggccgccgaggag
cccagcaaggtggaggagaaaaaggccgaggaggccggggccagcgccgccgcctgcgag
gccccctccgccgccgggcccggcgcgcccccggagcaggaggcagcccccgcggaggag
cccgcggccgccgcagcctcgtcagcctgcgcagccccctcacaggaggcccagcccgag
tgcagtccagaagcccccccagcggaggcggcagagtaa

DBGET integrated database retrieval system